(data stored in ACNUC7421 zone)

EMBL: CP002157.PE557

CP002157.PE557       Location/Qualifiers
FT   CDS_pept        602913..603470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01477"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00003"
FT                   /db_xref="GOA:A4AVS3"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVS3"
FT                   /protein_id="EAR00003.1"
FT                   /translation="MNKGELNIKSSDLTSSEELNISYEEIDTSKLVYQKQTDNIMLIIT
FT                   IIFGGFFTINLFNPDNYKDDGWFGVGLFLFMVTLFSAMITYVKSKNLVLIPTMNNGYIE
FT                   ILKAKPNQKQFDEFLSELTIRITTYLKSKYGTLDFDLPTEPQLMNLSWLKDREIITLDE
FT                   FENLKKQLINNGKGNSPVGFNK"
     atgaataaag gagaattaaa tattaagtca tccgacttaa caagctcaga agaactgaat        60
     atttcttatg aagaaatcga cacctctaag ctagtttatc aaaaacaaac tgacaatata       120
     atgttgataa tcacaataat atttggtggg tttttcacga taaatctttt taacccagat       180
     aactataagg atgatggatg gtttggtgtt gggcttttcc tttttatggt tacgttgttt       240
     agtgcaatga ttacctatgt taaatccaaa aaccttgtat taattccaac catgaacaac       300
     gggtatattg aaattttgaa agcgaaacca aatcaaaaac agtttgatga gtttttaagc       360
     gagttaacaa tcagaataac tacatacctt aaatcaaaat atggaactct agattttgat       420
     ttaccaactg aacctcaatt aatgaattta tcctggctaa aagaccgaga aataattacc       480
     cttgatgaat tcgaaaattt gaaaaaacaa ttaataaata atggaaaagg gaatagtcct       540
     gtagggttta ataaataa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page