(data stored in ACNUC7421 zone)

EMBL: CP002157.PE56

CP002157.PE56        Location/Qualifiers
FT   CDS_pept        69470..70081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16411"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00685"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB5"
FT                   /protein_id="EAR00685.1"
FT                   /translation="MGLIDKLFGGGKKKVSKETAETRGVHMPDLNIPVDEKFTIHFKNN
FT                   GGKFIYCDSFQEISEALKNIVIENSWENQPFFAMNPMLEDRFAKETISFTHKTKESEVF
FT                   FTTCEHLIAQNGSILVCSNQLMEKKLNELPGNVIVFATTSQLVESIGEGLKKIKKKYGH
FT                   SIPANITTLKHFQATNENSNDFLTYGSSSKNLYLLLLEDL"
     atggggctaa ttgataaact ttttggtggt ggaaagaaaa aggtttctaa ggaaacagca        60
     gaaacccgag gggttcatat gcctgatttg aacattcctg tagacgaaaa attcaccatt       120
     cactttaaaa ataatggcgg taagtttatt tactgcgatt catttcagga gatatcagaa       180
     gcgcttaaaa acattgtcat agaaaatagt tgggaaaatc aacctttctt tgccatgaat       240
     cctatgcttg aagataggtt tgccaaggaa acaataagct ttacacataa aaccaaagaa       300
     agtgaagtat tcttcacaac ttgtgagcat ttgatagcac aaaatggttc tatcttagtt       360
     tgctccaacc agttgatgga aaagaaactc aatgagctcc ctggcaatgt tattgttttt       420
     gcgactacaa gtcaacttgt tgaatccatt ggtgaaggct taaagaaaat taaaaagaaa       480
     tacgggcata gtattccagc gaacataact acgttaaagc actttcaggc cacaaacgaa       540
     aactcaaatg attttttaac atacggtagc agctccaaaa atttgtacct tttacttttg       600
     gaagatctat ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page