(data stored in ACNUC7421 zone)

EMBL: CP002157.PE567

CP002157.PE567       Location/Qualifiers
FT   CDS_pept        610216..610809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01527"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00013"
FT                   /db_xref="GOA:A4AVT3"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT3"
FT                   /protein_id="EAR00013.1"
FT                   /translation="MKKKALLIIGSIGIIYFFVSYLLPNYIGVPLAAYESYKNRSEYEK
FT                   ENSGNRLNELVLDSIGDFPFPIGSVSDYEKVFSEGQILKLTEIISSYEQETTREIAIVS
FT                   VSSIEPYIDIQKYSTDLANEWGIGKAETNNGLLILFSKNLQEISISTGLGTEKILTDEI
FT                   CKKVIDSTIIPQFKNGKYLAGIEKGMAELTKQWD"
     atgaagaaaa aagcattact aataattggg tcgattggca taatctattt tttcgtttcc        60
     taccttctgc caaattatat tggtgtacct ctagctgctt acgaatccta taaaaaccgg       120
     tctgaatatg aaaaagaaaa ttccggcaat agattaaatg aactcgtttt agacagtatt       180
     ggggattttc cttttcctat tggttctgtt tcagattatg aaaaagtatt tagtgaaggt       240
     caaatcttaa aactgactga aataatttcc agctatgaac aagaaactac acgagaaatc       300
     gcaattgtat ctgtaagcag tattgagcca tatattgata ttcaaaaata ctcgacggat       360
     ttagcgaacg aatggggaat tggaaaagct gaaacgaaca atggactttt gatattattt       420
     agtaaaaatc tacaggaaat tagtatttcg acgggattgg ggacagaaaa aatattgacc       480
     gacgaaatat gcaaaaaagt cattgattca actataattc ctcaattcaa aaatggaaaa       540
     tatcttgccg gaatagaaaa aggaatggca gaattaacta agcaatggga ttaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page