(data stored in ACNUC7421 zone)

EMBL: CP002157.PE572

CP002157.PE572       Location/Qualifiers
FT   CDS_pept        614290..616392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01552"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00018"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT8"
FT                   /protein_id="EAR00018.1"
FT                   /translation="MKKNIFISIAFVFCNLIINAQNRLYVSPLGNDLNPGTSELPLASL
FT                   TGARNVIREYKKKNVQSVSFVVTIADGIYTMKEPFVLTHEDGGTSEHPILYKAERGASP
FT                   IFSGGKKIGGFTIKENGVWETTIPESKYYKWRFDQLYVNNKRAVLARTPNIGFLKIGGV
FT                   AENIWERGTGRTPEKAQQILTFDKDDFESIQRLSDDDLELIRFRTYHKWDFTIRHIDKI
FT                   DKDSLALFTSGEGMKPWNPLKKDGRIVFENYESALDSAGEWFLNNEGILSYIPLPGQTP
FT                   ENTEVIAPVLENLISIKGDIANNKFVTHIKFEGLAFKHSHYRLPRTGFEPNQAATEIPS
FT                   SVMLVGAKNIAFSNCEISHTGQHAIWFGKGCSNSLLSQCYINNIGGGGIYLGDVAPLEG
FT                   VEHTHHIKLDNNIIHSGGQEFPPAVGIWVGHSSENEITHNDIGNFYYTGISVGWIWGYK
FT                   PSFAKRNKITYNNIHHIGWDLLSDMAAVYTLGKSEETVVSNNVIHHVHAYSYGGWGLYP
FT                   DEGSSDIVMENNLVYSTKTGGFHQHYGKNNTIRNNIFAYSKMYQAQCTRVEEHRSFNFS
FT                   NNIIVFDKGVVLNGAWNKIDIYMDSNLYWNTGGNTYDFNGKSFKEWQKSGNDINSIIKN
FT                   PNFKDAPNFDFRLRNNKSIRKINFRPFDFSKAGVYGGIEWIGKSKLPKHITEDFDKVVE
FT                   ENMNRD"
     atgaagaaaa acatctttat tagtattgca tttgtttttt gtaatttaat tataaatgcc        60
     caaaatagac tatacgtttc cccattggga aatgatttaa acccaggcac atcagaacta       120
     ccattagctt cattgacagg ggctcgcaat gttattcgcg aatacaaaaa aaagaatgtg       180
     caatcagttt cctttgttgt aaccattgct gatggtattt atactatgaa agagcctttt       240
     gttttaacgc atgaagatgg tggcacatct gaacatccta tactttataa agcggaaaga       300
     ggagcttctc cgatttttag tggaggaaaa aagataggtg gatttaccat aaaggaaaat       360
     ggtgtttggg aaacaaccat tccggaaagc aagtactata aatggagatt cgaccagctc       420
     tatgttaata ataaaagagc ggttctagct cgaaccccaa acataggctt tttaaaaata       480
     ggtggcgttg cagaaaatat ttgggaaaga ggaactggac gtactccaga aaaagcgcaa       540
     caaatattaa cttttgataa agatgatttt gaatcaatac agcgactaag tgatgatgat       600
     ttagaactta tacgtttccg tacgtatcat aagtgggatt ttactattag acatatcgat       660
     aaaattgata aagatagctt ggcattgttc acttccggcg agggaatgaa accatggaat       720
     ccattaaaaa aagatggccg tattgttttt gaaaattatg aatccgcttt agattcagct       780
     ggagaatggt ttcttaataa tgagggcata ttgtcatata taccgctacc tgggcaaact       840
     cctgaaaaca cagaggtgat agcaccagtg ttagagaatc taatatccat taaaggagac       900
     atagccaata ataaatttgt aacgcatatc aaatttgaag gccttgcatt caagcatagt       960
     cattatcgtt taccaagaac cgggtttgaa ccaaatcagg cggcaaccga aattccttca      1020
     tccgtaatgc ttgtaggggc aaaaaatatt gctttttcta attgtgaaat ctcccataca      1080
     gggcaacacg ccatatggtt tggtaaagga tgtagcaatt ctctcttaag tcaatgctat      1140
     atcaacaata ttgggggtgg tggcatttat ttaggtgatg ttgctccatt agaaggtgtt      1200
     gaacatacac atcatattaa attagataac aatattattc attcaggagg gcaggaattt      1260
     ccacccgctg ttggcatatg ggtaggacat agttctgaaa atgaaataac acataatgat      1320
     attggaaatt tttactacac aggtatttca gtaggatgga tttggggcta taaaccaagt      1380
     ttcgccaaaa gaaataaaat tacttacaac aatatccacc atattggttg ggacttatta      1440
     agcgatatgg ctgccgtcta taccttgggt aaatcagaag aaactgttgt tagcaacaat      1500
     gtcatacacc atgtacatgc atattcttat ggaggatggg ggctataccc agatgaaggc      1560
     tcgtctgaca ttgtaatgga aaacaacctg gtttatagca ccaaaaccgg tggtttccac      1620
     caacattatg gtaaaaacaa taccataaga aacaatattt ttgcttattc caaaatgtat      1680
     caggcacaat gcacaagagt tgaagaacat cgctcattta attttagcaa caatattatt      1740
     gtttttgata aaggtgttgt tttaaatggg gcctggaata aaatcgatat ttacatggac      1800
     agcaacttat attggaatac aggaggcaat acctatgatt ttaatggtaa atcttttaag      1860
     gaatggcaaa aatcggggaa tgatataaat agcattataa agaatccgaa ttttaaagac      1920
     gcccctaatt ttgattttag gttaagaaat aataaaagca ttagaaaaat aaacttcaga      1980
     ccttttgatt tttcaaaagc aggggtttat ggaggtatcg aatggatagg caaatcaaaa      2040
     ttacctaagc atattacaga agattttgat aaagtcgttg aagaaaatat gaatagggat      2100
     tag                                                                    2103
//

If you have problems or comments...

PBIL Back to PBIL home page