(data stored in ACNUC7421 zone)

EMBL: CP002157.PE573

CP002157.PE573       Location/Qualifiers
FT   CDS_pept        616407..617747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01557"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00019"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVT9"
FT                   /protein_id="EAR00019.1"
FT                   /translation="MNKMNILSKIKIALTPAVLFVLLCCNQFVYGQVEKPFTKKFDYNV
FT                   NMLICYGQSLSVGGGATNSQSNFRNTISFKGGCNEWASKVNINNPESVANFYGDEFVLL
FT                   DSITNKSWPPAASIAVSWMNLLEKEDNIDLSEFDNQFLLSTPGYSGISIEKLSKNTEYY
FT                   QRLLLGVKKGYEFSKKTNKTFGVPCLFWVQGEANVKTDTEEQYYDKLKRIFIDLNNDIK
FT                   SITKQKKDVVFITYQTAPVIGTVPYPSIENPRTYDDCGPSFAQLKLAKEKNNVFMGGAM
FT                   YQYDYGDLWHPRDRATVGIQLGIVAKRIVNDNVSMDTFSPIKYKVKNKDSEWILSIKFE
FT                   VPVSPMRFDTSADKFHNLNGKQKNYGFSLKNEKGEDIISNEPYIKKGNTLVIKCTENPK
FT                   NAKLSYALNGHYGGGNLCDSQNIRINNKNAKYVIDNFCPAFRNYNIK"
     atgaataaaa tgaatatact ttcaaaaata aaaattgcac taaccccagc tgttttattt        60
     gtattactct gctgtaatca attcgtttat ggtcaagtag aaaaaccatt caccaagaaa       120
     tttgattaca acgttaatat gttaatatgc tacggacaaa gtctatcagt gggaggagga       180
     gccacaaatt cccaaagcaa cttccgaaat actatttctt ttaaaggagg ttgtaatgaa       240
     tgggcttcaa aggtcaatat taataaccct gagagtgttg ccaatttcta cggagatgaa       300
     tttgttcttt tagattcaat aaccaataaa agttggcctc ctgctgcttc aattgcagta       360
     agttggatga accttctcga aaaggaggac aatatagatt tatccgaatt tgacaatcaa       420
     tttttacttt caactccagg ttattcaggt atttctattg aaaagttatc aaaaaacact       480
     gaatattatc aacgtcttct cttaggagtt aaaaagggat atgaattttc gaagaagacg       540
     aacaaaactt ttggtgttcc ttgtctcttt tgggttcaag gagaagcaaa tgtaaaaaca       600
     gacactgaag aacagtatta tgataaattg aaaaggatat tcattgattt aaataatgac       660
     atcaagtcaa taaccaagca aaaaaaggat gttgtcttta tcacctacca aactgcccct       720
     gtaattggaa ctgtgccata cccttcaatc gaaaacccta gaacatatga tgattgcggc       780
     cctagttttg ctcaattaaa attggcaaaa gaaaaaaaca atgtttttat gggcggagct       840
     atgtatcagt atgattatgg tgatctttgg catccgagag atagagctac tgtgggcatt       900
     cagttaggta tagttgccaa aagaatagta aatgacaatg tctcaatgga tacattttcc       960
     ccaataaaat ataaagtaaa aaataaggat tctgagtgga tattatcgat caaatttgaa      1020
     gttcccgttt ctccaatgag gtttgataca tcggcggata aatttcataa tcttaatggg      1080
     aaacaaaaga attatgggtt tagccttaaa aatgaaaaag gagaagacat tatcagtaac      1140
     gaaccttata taaaaaaggg taatacatta gttattaagt gtaccgaaaa cccaaaaaat      1200
     gccaaattaa gttatgctct gaatggtcat tacggaggag gaaatctctg tgattcacaa      1260
     aatattagaa ttaataataa aaatgcaaaa tacgttatag acaacttttg tccagcattc      1320
     agaaattata atattaaata a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page