(data stored in ACNUC7421 zone)

EMBL: CP002157.PE575

CP002157.PE575       Location/Qualifiers
FT   CDS_pept        618778..619395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01567"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00021"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU1"
FT                   /protein_id="EAR00021.1"
FT                   /translation="MKLDRKKHWETVYETKNPKQVSWTQEIPKTSLDFIHSFGLNKTSK
FT                   IIDIGGGDSKLVDHLLDEGFENITVLDISAKSLEKVKNRLGEKANKVNWIVSDITEFES
FT                   NMTFDVWHDRATFHFLTSPDQIKKYMITARKSVKGFLTIGTFSQNGPKQCSGLDIKQYN
FT                   EDELTSELKDGFVKIKCVTEDHLTPFDTTQNFLFCSFKKQLN"
     atgaaattag acagaaagaa acattgggaa actgtttatg aaacaaaaaa tccaaagcaa        60
     gtaagttgga ctcaagaaat accaaaaact tcacttgact ttatacattc attcgggcta       120
     aataagactt cgaaaataat tgatattggt ggtggcgaca gtaaacttgt agatcactta       180
     cttgatgaag ggtttgaaaa tattactgta cttgacattt ctgccaaatc acttgaaaaa       240
     gtaaaaaatc gacttggaga aaaagcaaat aaagtaaatt ggattgtaag tgatattaca       300
     gaatttgaat caaatatgac ttttgatgtt tggcacgaca gagcgacttt tcattttctc       360
     acttcgcccg accaaataaa aaaatatatg ataaccgcta gaaaatccgt caagggattc       420
     ttgacgatcg gaaccttttc acaaaatgga cccaaacaat gtagcggact tgatataaaa       480
     caatacaacg aagatgaatt aacatctgaa ttaaaagatg gatttgtcaa aattaaatgt       540
     gtaacagaag accatttaac accctttgat acaacacaga atttcttgtt ctgtagtttt       600
     aaaaaacaat tgaattga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page