(data stored in ACNUC7421 zone)

EMBL: CP002157.PE576

CP002157.PE576       Location/Qualifiers
FT   CDS_pept        619524..620024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01572"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00022"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU2"
FT                   /protein_id="EAR00022.1"
FT                   /translation="MKKIGFYLLLISFLSCSKDNDDIINTDLVGIWENTFILEIGDISS
FT                   VQEEGFEHVVQYTFNLNQSFEYGSFIRNIDSGSILAYSHRYLGHYGIEGNRLNLIFEHW
FT                   GAEPLDNQYSELKNINELVLVTENETWSFSYSISQNKKLVFDYDPCGPLENCIDKSTLY
FT                   RIK"
     atgaaaaaaa tagggtttta tcttctattg atttcttttt tatcttgttc taaagacaac        60
     gatgacataa taaacactga tttagttggt atatgggaaa atacatttat actggaaatt       120
     ggtgatattt caagtgttca agaagaaggc tttgaacatg tggtccaata tactttcaat       180
     ttaaatcaat cattcgagta cggaagcttt attaggaaca ttgattcggg cagtatatta       240
     gcctatagcc atagatattt gggccattat gggattgaag gaaatagact gaatcttatt       300
     tttgaacatt ggggggcaga acctttagac aatcagtatt cggaattaaa aaatatcaac       360
     gaacttgtat tggttactga gaacgaaaca tggagttttt cttattcaat tagccaaaac       420
     aagaaattgg tatttgacta tgacccctgt ggccctcttg aaaactgtat tgataagtca       480
     actctttatc gaataaaata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page