(data stored in ACNUC7421 zone)

EMBL: CP002157.PE577

CP002157.PE577       Location/Qualifiers
FT   CDS_pept        620185..621171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01577"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00023"
FT                   /db_xref="GOA:A4AVU3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU3"
FT                   /protein_id="EAR00023.1"
FT                   /translation="MKLFKSLPKIDSHFHSTFYNPVYEKIAKEHNIKLININTNANVFP
FT                   SIEIQETIALEYIGKDKKHFSFIASFEMDGWENEGWYEKTIARIKKSMELGAVGIKIWK
FT                   NIGMELIKSSDKCYLMIDDPFFDPLFDYLSENKIPLLAHLGEPKNCWLPLDEMTSNRNK
FT                   LYYTNNPEFHAYLHPEIPHYNRQIQARDNVLAKFPDLAFVGAHLGSLEWSHEELSQRFD
FT                   KYPNFKVDLSSRLGHIQLQSKNGYDDIRNFFIKYSDRILYGTDAYDNPKRLISSLIDDW
FT                   KFLSTSDNCESTEISGNFKGIDLPEEILYKIYYENSIKTYYKSNKYN"
     atgaaattat tcaagagctt accaaaaatt gattcccatt ttcattcaac cttttacaat        60
     ccggtttatg agaaaattgc aaaagaacat aatataaagc tcataaatat aaatacgaac       120
     gccaacgtat ttccatcaat agaaatacaa gaaaccatag ccttggaata tattggtaaa       180
     gacaaaaaac atttttcatt tattgccagt tttgaaatgg atggatggga aaatgaaggg       240
     tggtacgaga aaactattgc tcgaattaaa aaatcgatgg aattaggagc agttgggatt       300
     aaaatttgga agaatattgg aatggaactt attaaatcat ccgataaatg ctatttaatg       360
     attgatgatc cattttttga cccgctattt gattatttaa gtgagaacaa aatcccattg       420
     ttggcccatt taggagaacc caaaaattgt tggctgccat tggacgaaat gacatcaaat       480
     agaaacaagc tgtattatac caacaatccc gaattccatg cgtatttaca tccagaaata       540
     ccacactata accggcagat acaagctagg gataatgtac tggcaaagtt tcccgatttg       600
     gcttttgttg gtgcacattt gggaagctta gaatggagtc atgaagaatt atcccaacgt       660
     tttgataaat accctaactt taaagttgat ttatcctcgc gtttagggca tatacaattg       720
     caatcaaaaa atggatatga cgatattcgg aattttttca tcaaatattc cgataggata       780
     ttatacggta cagatgcata cgacaaccca aaaagactga tatcctcact tatcgatgat       840
     tggaagtttc tgtcaacaag tgataattgt gaatcaacag agataagtgg taatttcaaa       900
     ggaattgatt tgcccgaaga aattctttat aaaatatatt atgaaaattc aataaagaca       960
     tattataaat caaacaagta caactaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page