(data stored in ACNUC7421 zone)

EMBL: CP002157.PE578

CP002157.PE578       Location/Qualifiers
FT   CDS_pept        complement(621154..621522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01582"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00024"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVU4"
FT                   /protein_id="EAR00024.1"
FT                   /translation="MSRKAIRLPKPDLMIPFATKKAAKIRRIKLSEKPENAFSGGSTRN
FT                   KTTATNAIIEAVKIERASSKTPMMAVKKIANKCQASGVRSQGMGRCQMMTPSSRVILLF
FT                   THSNLWLVDGWFTLVVLV"
     atgagcagaa aagcaatacg ccttcccaaa cctgatttaa tgattccctt tgctaccaaa        60
     aaagcggcca aaataaggag gataaaactt tcggaaaaac cggagaatgc tttttcaggc       120
     ggaagcaccc gtaataagac tacggccacc aatgcaataa tagaagcggt gaaaatagaa       180
     agggcctcaa gtaaaacacc aatgatggca gtaaaaaaaa tagcgaacaa atgccaagcg       240
     tcaggtgtta gatcccaggg tatgggaagg tgccagatga tgacaccaag tagcagggtt       300
     atacttcttt ttacccatag taatttatgg ttagttgatg gttggttcac tttagttgta       360
     cttgtttga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page