(data stored in ACNUC7421 zone)

EMBL: CP002157.PE584

CP002157.PE584       Location/Qualifiers
FT   CDS_pept        complement(627148..628752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01612"
FT                   /product="sugar:cation symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01612"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00030"
FT                   /db_xref="GOA:A4AVV0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV0"
FT                   /protein_id="EAR00030.1"
FT                   /translation="MSSLEKLSVKEKIGYALGDGAANIAWRGVATFLFIFYTDVFGLSP
FT                   VTVGVLMLVARFSDGISDVLMGIIGDRTKSKYGKFRPWILWTAVPLAAILSLLFISPDL
FT                   GTSGKIAYAYITYIFFTLIYTANNVPYGALMAVMTGDDKERTSLGSYRMVGAFGGGMLV
FT                   QGALLFLVAYFGNVNPDVEVNKLADEKFRVVVSAPSDVENVNIKTEDGIAMFTWEETES
FT                   ASDENTPTHGKSFSIEADKKYAFIVDGEENLSQDKITIIDQKKGYSNSMYLMSIFLAIL
FT                   MFLTFYTTKERIQPPKEQKNNLKKDFKDLISNKPWLVLLVIGLLFNVYNSIKQGIVIIY
FT                   FTHYLNDQLLGASFLIGLMIASVIGAMVTSPLGKKFGKRNLFIYALIFSGGVNALLAFC
FT                   GPEDIGAIFTIGIISEFAAAIFPTLFFAMLGDAADYSEFKNGRRATGLIYSAGSFATKF
FT                   GGGLAGAIIGMILGAFHYNGQDANSIQGAIPGIIMLMSWVPAIITAIAAGLMLLYPLTQ
FT                   KKLDEITLELKNRRLQE"
     atgtcttcat tagaaaaact atcagtaaag gaaaaaatcg gatatgcgtt aggagatggc        60
     gcggcaaata ttgcatggag aggtgtagcc acctttttgt tcatatttta tactgatgtt       120
     tttgggttga gtcctgttac tgttggggtt ttgatgctag tcgctcgttt tagcgatggt       180
     attagcgatg tgttgatggg tatcatcggg gacagaacaa aatcaaaata cggtaaattc       240
     aggccttgga ttttatggac agcagttcca ttagcggcaa ttctttcatt gttgtttatc       300
     agccctgatt taggtacatc aggtaaaatt gcatatgcct acataaccta tatattcttt       360
     acgctgatat ataccgcgaa taatgtgcct tatggtgcgc ttatggctgt gatgacggga       420
     gatgataagg aacgtacgag cttgggttct tacagaatgg tcggtgcttt tggtggtggt       480
     atgttggtgc aaggagcctt gctttttttg gtggcctatt ttgggaatgt aaatcctgat       540
     gtcgaagtaa ataaacttgc tgatgagaaa tttagggtag ttgtttctgc tccatccgat       600
     gtagaaaatg tgaacattaa aacagaagat ggtatagcca tgttcacttg ggaggaaaca       660
     gaatcagctt ccgacgaaaa tacacctacg cacggaaaga gtttttcaat tgaggcagat       720
     aaaaaatacg cctttatagt tgacggagaa gaaaaccttt cacaggataa gattacaatc       780
     attgatcaaa aaaaggggta cagtaattca atgtatttga tgtctatatt tttggcgata       840
     ttaatgttct tgacattcta taccaccaag gaaagaattc aaccaccaaa agagcagaag       900
     aataatctta aaaaagattt caaagattta atttctaata aaccttggct agtactattg       960
     gtcattggcc ttcttttcaa tgtttataat tcaataaaac agggtattgt tattatttac      1020
     tttacccact atctaaatga tcaattgtta ggggcttcgt tccttattgg tttaatgatt      1080
     gcttcggtga ttggcgcaat ggtcacttca cctcttggaa aaaagttcgg aaagcgaaat      1140
     ctcttcatat acgcccttat tttctctgga ggtgtaaacg ctttacttgc gttttgtggc      1200
     ccagaagata ttggtgcaat attcactatt ggtattattt cagagttcgc agctgcaata      1260
     ttcccaaccc tattctttgc catgctcggt gacgctgctg attactccga attcaagaac      1320
     gggcgaaggg ctactggtct aatttattca gcaggctcat ttgccaccaa gtttggtggt      1380
     ggtttagctg gtgccataat aggtatgata ttgggtgctt tccattataa tggtcaggac      1440
     gctaattcta tccaaggggc aattccgggg ataataatgt tgatgagttg ggtgccggca      1500
     ataattacgg caatagcagc aggtttaatg ctcctttatc cactcacaca aaagaaactt      1560
     gatgaaataa cattagagtt gaaaaacaga agacttcaag aataa                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page