(data stored in ACNUC7421 zone)

EMBL: CP002157.PE586

CP002157.PE586       Location/Qualifiers
FT   CDS_pept        complement(629707..629982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01622"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01622"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00032"
FT                   /db_xref="GOA:A4AVV2"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVV2"
FT                   /protein_id="EAR00032.1"
FT                   /translation="MGTKEKLSEELLLEKEAVKQNEIVLFNDEVNTFDHVIDTLIAACD
FT                   HTPEQAEQCSLIVHYNGKCTVKTGEYKDLEPRCSKLLQAGLSAEIV"
     atgggtacca aggaaaaact ttcagaggag ctacttttag agaaggaagc cgtaaagcag        60
     aatgaaatcg tacttttcaa tgatgaggta aatacttttg atcatgtaat tgatactttg       120
     attgctgcat gcgatcatac gcccgagcag gcagaacaat gttcattgat tgtccactac       180
     aatggaaaat gtacagtaaa gaccggggaa tataaagatc ttgaaccaag atgttccaag       240
     cttttacaag caggtttaag tgccgaaatt gtttag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page