(data stored in ACNUC7421 zone)

EMBL: CP002157.PE59

CP002157.PE59        Location/Qualifiers
FT   CDS_pept        71534..71800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16426"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00688"
FT                   /db_xref="GOA:A4ATB8"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB8"
FT                   /protein_id="EAR00688.1"
FT                   /translation="MKKETLLKNFEEAVEFLNSYKEPLPADLLLKLYAYYKIAKKNFDN
FT                   PGSKTPLINAFKANALIQAQDISREDAMKAYIKLVKKEIKTGS"
     atgaaaaagg agaccttact taagaatttt gaagaagctg ttgagttttt aaacagttac        60
     aaggagccat tacctgcaga tctgttactc aagttatatg cttactacaa gattgcaaaa       120
     aagaattttg acaaccctgg gagcaaaacc ccccttataa atgcattcaa ggcaaacgca       180
     ttgattcaag ctcaagatat tagtcgagaa gatgcaatga aagcatatat taagttagtt       240
     aaaaaagaaa tcaaaacagg ttcttag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page