(data stored in ACNUC7421 zone)

EMBL: CP002157.PE599

CP002157.PE599       Location/Qualifiers
FT   CDS_pept        641468..642142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01687"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00045"
FT                   /db_xref="GOA:A4AVW5"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVW5"
FT                   /protein_id="EAR00045.1"
FT                   /translation="MFDFLAKNYFIPLYVAALIISLIRYRYYFESVLKYFPMFIAYTLV
FT                   TELIGILIRDFEGFQIVYEESYHYANYLVFNIYDVVFFIYFYSLFWRVVKNLKSRRIIM
FT                   YGALIYVIAAIVNPFFQNVLVFPQIYASTVGSIILIVAIFLYYNEIKKQKEKKRNLMVW
FT                   ISFGLLVFNLLFPFISLTARFDYDLYQRLFLRQIHYILIVIMYSCFVLGFLLMRQMRPK
FT                   EA"
     ttgttcgatt ttttagcaaa aaactatttt attccactct atgtggccgc attgattatt        60
     tctttaattc gctatcgtta ttatttcgaa agtgttttaa aatattttcc gatgttcatc       120
     gcatacacac tagtgacaga attaattggt attttaattc gggattttga aggttttcaa       180
     attgtttatg aggagagtta tcactatgca aactatcttg tattcaacat ttacgatgtt       240
     gttttcttta tatacttcta ttccttattc tggagagttg taaagaattt aaaatctaga       300
     cgcattatta tgtatggagc tctaatttat gttatcgcgg caattgtcaa tccttttttt       360
     caaaatgtcc tggttttccc tcaaatatat gcatcgactg taggttccat tattctgata       420
     gttgctattt ttctttatta taatgagatt aagaaacaaa aagaaaagaa gcgaaatcta       480
     atggtttgga taagttttgg tctcttggtt tttaatcttt tatttccatt tatttcgctc       540
     actgcccgat ttgactatga cctttaccaa agattatttc ttagacaaat tcattacata       600
     ttaattgtaa ttatgtattc ttgttttgtc ctaggttttt tacttatgag acaaatgcgc       660
     ccaaaagaag cctaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page