(data stored in ACNUC7421 zone)

EMBL: CP002157.PE60

CP002157.PE60        Location/Qualifiers
FT   CDS_pept        complement(71807..72571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16431"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00689"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB9"
FT                   /protein_id="EAR00689.1"
FT                   /translation="MIRPYILAETNWKALENAKFDLAILPWGATEAHNYHLPYATDVYE
FT                   SDALAAESARLAWEKGSKVIVLPSIPFGVNTGQSDIYLDINLNPTTQLAILADVIEVLN
FT                   RQGIKKLLIFNSHGGNNFKPLVRELGLKFPEMFICFSNWFQSLNKTEYFDEEGDHADEM
FT                   ETSLMLYLRPDLVLPKKIWGLGSSKKFKIKSFSEGWVWAERKWSEVSEDTGIGNPMQST
FT                   TEKGERFFKDVTIKIGQFIHELSNSDLADQYE"
     atgattagac catatatttt agcagaaacg aactggaaag cgctagaaaa tgccaaattt        60
     gatttggcta ttttgccatg gggagcaact gaagcacata attatcatct gccatatgct       120
     actgatgttt atgagagtga cgctcttgct gccgaatcag ctaggttggc ttgggaaaaa       180
     gggagcaagg tcattgttct accatctatt ccttttgggg tcaatactgg tcaatcagac       240
     atctatctcg atattaattt aaaccctacg actcagttgg caattttggc agatgtgata       300
     gaagtactta accgtcaggg aataaaaaag ttactgattt tcaatagtca cggaggaaat       360
     aattttaaac ccttggtaag agaactgggt ttaaaatttc ctgaaatgtt catttgtttt       420
     tctaattggt tccaatcact gaacaaaact gaatattttg atgaagaagg ggatcatgcc       480
     gatgaaatgg aaactagcct tatgctctac ctaagacctg atttggtact ccccaagaaa       540
     atatggggtt tgggttcttc caaaaaattt aaaatcaaat cattttccga aggatgggtt       600
     tgggcagaac gcaaatggtc agaagtcagt gaagatacag ggattggtaa tccaatgcaa       660
     tcgacaacag aaaaaggtga gcgtttcttt aaagacgtga ccattaaaat tggacaattt       720
     atccacgaat taagtaattc agatttagca gaccaatacg agtag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page