(data stored in ACNUC7421 zone)

EMBL: CP002157.PE600

CP002157.PE600       Location/Qualifiers
FT   CDS_pept        642198..642896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01692"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00046"
FT                   /db_xref="GOA:A4AVW6"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVW6"
FT                   /protein_id="EAR00046.1"
FT                   /translation="MVSELTDFLFNNYFLAFYALALVFSLVTYKKYFDTVLKYLPILIT
FT                   YTLITEILGLLIRDVEEIQIVYLDGYSYYNLLIYNIFDIIFFLFFFYVFWIVLYAKRFK
FT                   RLIKYGGILFIIVSLVNPFFQDFVLSPQLFASTVGSVVLIACIWFYFIQLKSNQEIRNN
FT                   RDLLFWISIGLLVFYSFYPFIFIIGHYDHGLYQELYIRQILHLLIAFMYSCFILGFLLA
FT                   KRNVRQKKMP"
     atggttagcg aacttacaga ctttctattc aacaattatt tcttggcttt ctatgccttg        60
     gctttggttt tttctttggt cacctataaa aaatactttg acactgtttt aaaataccta       120
     cccatactca taacatatac tctgatcacg gaaatccttg gtctcttgat tagggatgtt       180
     gaggaaattc aaattgttta tttagatgga tactcatatt acaacctcct gatttacaat       240
     atattcgata ttatattctt cttattcttt ttttacgttt tctggattgt actttatgcc       300
     aaaaggttta agcgattaat aaaatatggt ggaatacttt ttattattgt tagtctagtc       360
     aacccatttt ttcaggattt tgttctctca ccacaattat ttgcttcaac tgtaggatcg       420
     gtcgtattaa ttgcctgcat atggttttat tttattcaat tgaaatcaaa ccaagaaatt       480
     cggaataata gggacctgtt attttggatc agtatagggc ttttggtttt ttattctttt       540
     tacccattca tatttatcat agggcattat gaccatggtt tatatcaaga gctgtatata       600
     cggcaaatac tacatctatt aatagcattt atgtactctt gctttatcct aggctttttg       660
     ctcgcaaaaa gaaacgtaag gcaaaaaaaa atgccctga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page