(data stored in ACNUC7421 zone)

EMBL: CP002157.PE605

CP002157.PE605       Location/Qualifiers
FT   CDS_pept        646015..646581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01721"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99638"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM4"
FT                   /protein_id="EAQ99638.1"
FT                   /translation="MVVQEVVPIQEEQALTEVILPLEELLVLTKTELIVQVEVLGQPQD
FT                   IIVHPGTVNITEAVPLEVAHIEVVLLELEALQDLLLQEVLPTEVQVVVLEVVLHIEVLE
FT                   EALEVHNLIEVRRQGAVAIDQEAKVQVLEAAAATEVLEVAPEVQAVAQEALGALQDHQV
FT                   AGLLRAEAVVEDNKSGLFKRDIQKK"
     ttggtagtac aagaagtagt gccaatacaa gaagaacaag cacttacaga agtaattcta        60
     ccgctcgaag aactgttggt gttgaccaaa acagagctta tcgtacaagt agaagtacta       120
     ggacaacccc aagatataat agttcatcca ggaacagtca atattacaga agcagtaccc       180
     ctagaagtag cacatataga agtggttctt ctggaactcg aagcactaca agatcttcta       240
     ctccaagaag ttctacctac agaagttcag gtagtcgtac tagaagtggt tctacatata       300
     gaagttctgg aagaagcact agaagttcac aatcttatag aagttcggcg ccaaggagca       360
     gtagctatag atcaggaagc aaaagttcaa gtactagaag cagcggcagc tacagaagtt       420
     ctggaggtag ctccagaagt tcaggcagta gcgcaagaag ctctgggggc tcttcaagat       480
     catcaagtgg ccggtcttct tcgggcagaa gcggtggtag aagacaataa atctggatta       540
     ttcaaaagag acattcaaaa aaaataa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page