(data stored in ACNUC7421 zone)

EMBL: CP002157.PE606

CP002157.PE606       Location/Qualifiers
FT   CDS_pept        646583..648085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01726"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01726"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99639"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM5"
FT                   /protein_id="EAQ99639.1"
FT                   /translation="MKRYLTFIVILACTLVSAQNINDVLRFSHENLQGTARFQGMSGAF
FT                   GALGGDLSALSVNPAGSAVFNNGLVTISGTHYEMDNLANYFGTYSGIKTNDVDINQFGG
FT                   VFVFKSNGNSDWKKMAIAINYDIVQNFDDEFNIQGDSNQGIDNYFLSFAQGVPFGSILL
FT                   QDGEYIEDGYLDIGSNQGFGDQQAFLGYYGGILDPEDQDEATTTYNSNALYDNVNHNFL
FT                   RLTSGFNSKFTFNLASQYQDKLYLGASLNFHTIFYDQVDEFRENGYDTSSPIQNTDFFN
FT                   FLHTEGSGFSFTLGAIAKLNQSVRLGGSYQSPTWYRLTDDFSQRIDSDLADDDINFINF
FT                   DVVNLFEAYTIKTPAKLTGSMALVFGKEGLLSFDYGYQDMSQAELRPTSDSSFATINSE
FT                   IANNLGAVSSFRLGGEYRVDQVSLRAGYRFEQSPYSDGNNIGDLTGYSGGLGYNFGGSK
FT                   LDLAVNRTEQDYNMQLFNTGITTPALINKINTNVTLSYTMNF"
     atgaaaagat atttaacttt catagtgatt ttggcatgca ccttagtaag cgcccaaaac        60
     ataaatgacg tattacgatt cagccatgaa aatttacagg gaacagctcg ctttcaaggt       120
     atgagtggtg catttggagc tttgggcggt gacctttcgg ctcttagtgt taacccagcc       180
     ggatctgccg ttttcaataa cggtttagtt acaatttctg gcacccatta cgaaatggat       240
     aatttggcca actactttgg aacctattcc ggaatcaaaa ccaatgatgt tgatattaat       300
     caatttggtg gtgtctttgt ttttaaaagt aacggcaatt ccgattggaa aaaaatggca       360
     atagccatca actatgacat agttcagaac tttgatgatg aattcaacat acagggggat       420
     agtaatcaag gaatcgataa ttattttctg agttttgccc aaggggttcc ttttggttca       480
     attttacttc aggacggaga atatattgaa gatggttatc tagatatagg ttctaatcag       540
     ggatttggtg atcaacaggc atttttagga tactacggag gtattttaga tccagaagac       600
     caggatgaag ccaccacaac atataatagc aatgcattgt acgacaatgt aaaccataac       660
     tttttaagat taacctcggg gtttaatagc aaatttacat tcaatctcgc ctcacagtat       720
     caagataagc tttatctagg tgcatcattg aactttcaca caatatttta tgatcaagtt       780
     gatgaatttc gtgaaaatgg ttatgatact tcctcaccaa ttcagaatac agattttttc       840
     aattttctac atactgaagg ttcggggttc tcatttactt tgggagctat agctaagcta       900
     aaccaaagtg taagacttgg aggtagttat caatcaccaa catggtatcg cttaaccgat       960
     gatttttctc aaagaatcga ttctgaccta gctgatgatg atatcaattt tataaacttt      1020
     gatgtcgtta accttttcga agcatacacc ataaaaacac ctgcaaaact tacgggtagt      1080
     atggctttgg tttttggcaa ggaaggactt ctaagctttg actacggcta tcaagatatg      1140
     tcacaggctg agttaagacc aacaagtgat tcaagtttcg cgaccattaa ttcagaaata      1200
     gccaataatc ttggcgcagt atcttctttt agattaggtg gagaataccg cgtggaccaa      1260
     gtaagtcttc gtgcaggtta caggtttgaa caaagtcctt attccgacgg aaataatatt      1320
     ggtgatctaa cagggtattc tggcggactt ggttacaact ttggggggag taaattagac      1380
     cttgccgtaa atagaacaga gcaagattat aacatgcagt tgtttaacac tggtattacc      1440
     acacctgccc taattaacaa aataaacaca aatgtaactt taagttatac catgaatttc      1500
     taa                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page