(data stored in ACNUC7421 zone)

EMBL: CP002157.PE61

CP002157.PE61        Location/Qualifiers
FT   CDS_pept        complement(72581..73852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16436"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00690"
FT                   /db_xref="GOA:A4ATC0"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC0"
FT                   /protein_id="EAR00690.1"
FT                   /translation="MEAYANALLYAIPFFMILLIIEIAYGYFIKNQKHKVLDSVSSISS
FT                   GLTNIIKDSLGIGIIIVSYPYLLENIALLEIKATWLVWLIAFLALDFAGYWNHRLSHKV
FT                   NFFWNQHVIHHSSEEFNLACALRQSISNLLGYFPLLLIPAALLGVPSKVIAILAPIHLF
FT                   AQFWYHTQYIGKMGWLEYIIITPSQHRVHHAINPEYIDKNLGQILCVWDRWFGTFQEEL
FT                   KDVPPQYGVLKPAATWNPIIINFQHIWRLMKDAWRTKNLLDKLRIWFMPTGWRPEDVKE
FT                   KYPIQIIEDVYHFERYETRASSALKGYSIFQLLMTTALLLFMFYNYSKIGIDGLLLFGA
FT                   FVFVGIYGYTTLMDGKIYAVWIETIRAILGLALIWITGDWFGIDSYSSFGSRFVAIYFL
FT                   ITIIAALYFTFFEGSPPLNKATLN"
     ttggaggcct acgcaaatgc ccttttatat gcgattccct tttttatgat tcttctgatc        60
     atagagattg cctatggtta ttttataaaa aatcaaaagc ataaggtgct cgattctgta       120
     tcgagtataa gttcgggact tactaatatc atcaaggatt cattgggtat tggtattata       180
     attgtcagtt acccttattt attggagaat attgccttat tagaaatcaa ggcaacgtgg       240
     cttgtttggt tgatagcgtt tttggcctta gattttgctg ggtattggaa ccatcgatta       300
     agtcataaag ttaatttttt ttggaaccaa catgttatac accatagcag tgaggagttt       360
     aatcttgctt gcgccctacg gcaatcaatt tcaaatcttc ttgggtactt tccattgtta       420
     ttgattcctg cggcacttct tggagtaccg agtaaggtta tcgcaattct agctcctata       480
     catttatttg cccaattttg gtaccatacg cagtatattg ggaaaatggg gtggttggaa       540
     tatattatta taaccccttc tcaacatcgg gttcaccatg caattaatcc agaatacatt       600
     gataaaaatc ttggacagat tctttgtgtt tgggatcgtt ggtttggtac atttcaagaa       660
     gaacttaaag atgttccacc tcaatacggg gtattgaagc cagctgccac ttggaatcca       720
     atcatcatta attttcaaca tatttggcgc ttgatgaagg atgcctggcg caccaagaat       780
     ttattggata aattacgtat ttggtttatg ccaaccggtt ggagacctga agatgtcaaa       840
     gaaaaatacc ccattcaaat cattgaggat gtatatcatt ttgaacgata cgaaacacgg       900
     gcatcatcag ctctaaaagg atattcaatt tttcaattat tgatgacaac agcactgttg       960
     ctctttatgt tctataatta ttctaaaata ggcattgatg ggttgttatt gttcggagcg      1020
     tttgtttttg tcggtatcta cgggtatacc actttaatgg acggtaaaat ttatgcggta      1080
     tggattgaaa ctatacgcgc catattaggc cttgcgctga tctggataac gggtgattgg      1140
     tttggaattg attcttattc cagttttgga agcaggtttg ttgctatcta tttcctgatt      1200
     actataattg ccgcattgta ttttaccttt tttgaaggta gtcccccttt aaataaagcc      1260
     actcttaatt ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page