(data stored in ACNUC7421 zone)

EMBL: CP002157.PE611

CP002157.PE611       Location/Qualifiers
FT   CDS_pept        653858..654097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01751"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99644"
FT                   /db_xref="GOA:A4AWN0"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN0"
FT                   /protein_id="EAQ99644.1"
FT                   /translation="MENRITVKKVLIAPFVLLVKFYQYAISPYTPATCRYSPTCSHYTL
FT                   EALQKHGLFKGGWLSIKRIFSCHPWGGKGYDPVP"
     atggaaaata gaatcacagt gaagaaagta cttattgcac cttttgttct gttggtcaag        60
     ttctaccaat atgcaatttc gccatacaca cctgcaactt gtcgctattc ccctacctgt       120
     tcacactata cattagaggc tttgcaaaaa catggtctct ttaaaggagg ttggctttct       180
     ataaagcgta ttttcagttg ccatccgtgg ggaggaaaag gttatgaccc cgttccttaa       240
//

If you have problems or comments...

PBIL Back to PBIL home page