(data stored in ACNUC7421 zone)

EMBL: CP002157.PE615

CP002157.PE615       Location/Qualifiers
FT   CDS_pept        656277..657515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01771"
FT                   /product="putative anion transport protein (ABC
FT                   superfamily, ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01771"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99648"
FT                   /db_xref="GOA:A4AWN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN4"
FT                   /protein_id="EAQ99648.1"
FT                   /translation="MLAKAHWAIFIDNSSEKIAFIDNLFNGNIPEALISIKGLKGALFS
FT                   KLALLKLIVKESRHGDSGITGNSKQSLQTMSSGEQKRVLLNYLLNTKPDFLVLDNPFDN
FT                   LDQDFQVEFQTTLKSLSKNIIIIQIISRKNDLLPFVSNYAQLRESEFLKLPKLDNLNPN
FT                   VNLEYFNGSIPPPLKWSEYKDTILIELNKVNVSYAEKPILKNISWQINKGDFWELSGKN
FT                   GSGKTTLLSMITGENPKGYGQDLYLFGFKKGSGESVWDIKKNIGYFTPSMTDKFTGYHS
FT                   VEHMIISGILDSVGLYVRPTEAQTRLAKEWLKLINLWEMKDTLFHDLTMGQKRLVMTTR
FT                   AMIKHPLLLILDEPTAGLDDESAMLLVNLVNKIALESSSAIIFVSHRKEPGLSPTNQLI
FT                   LKTSDMGSIGQTS"
     atgctagcta aagcgcattg ggccatattc atagataatt cctcggagaa gattgctttt        60
     atcgataatc tgttcaatgg aaatattcct gaagcactaa tttcgataaa aggtttaaag       120
     ggtgctcttt tctccaaact ggctctactt aaattaattg ttaaagaaag taggcatgga       180
     gatagcggaa ttactggtaa tagtaagcaa tcattgcaga ccatgtccag tggcgaacaa       240
     aagagggttc ttttaaatta cttattaaat accaaaccgg acttcctggt attagacaat       300
     ccctttgata atttagatca agatttccaa gttgaattcc aaacgaccct aaaatcacta       360
     tcaaaaaata tcataataat ccagataata agtcgaaaaa atgacttgct tccttttgta       420
     tccaactatg cgcaactaag agaaagtgag ttcttaaaat tgccaaaact agacaaccta       480
     aatccaaatg taaatttgga gtattttaac ggttctatac ctcccccttt gaaatggtcg       540
     gaatacaaag acacgatatt aattgagctt aacaaagtga atgtgagtta cgctgagaag       600
     ccaattttaa aaaatatctc atggcaaatc aacaaaggtg atttttggga actaagtggc       660
     aaaaacggaa gcggaaaaac aacactttta tccatgatta ctggcgaaaa cccaaaagga       720
     tatgggcaag acctttactt atttggattt aaaaaaggca gtggggaaag tgtttgggat       780
     attaaaaaga acattggcta ttttacacct tcaatgaccg ataaatttac tggctatcac       840
     tccgtggaac atatgattat ttcaggcatt ctagattctg tcgggttata cgtaaggcca       900
     acggaagccc aaactagatt agcgaaagaa tggttaaaac tcattaattt gtgggaaatg       960
     aaagatactc tttttcatga tctcacaatg ggccaaaaaa ggttggttat gaccactcgt      1020
     gcaatgatca aacatccttt attattaatt ttggatgaac cgacggccgg tcttgacgat      1080
     gaatcagcaa tgcttcttgt caaccttgta aataaaatcg ctttagaaag ttcttctgcc      1140
     attatctttg tttctcacag aaaagagcct ggtttgtccc ctaccaatca attaatactt      1200
     aaaacaagtg atatgggttc catcggtcag acctcatag                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page