(data stored in ACNUC7421 zone)

EMBL: CP002157.PE616

CP002157.PE616       Location/Qualifiers
FT   CDS_pept        657678..657872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01776"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01776"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99649"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN5"
FT                   /protein_id="EAQ99649.1"
FT                   /translation="MNSLGLELLAKKFLKGLNFRSKVAGLAKKEPENIIMDSSGVVGRL
FT                   TNYFRLCNNLSFEPNRFAK"
     ttgaattcac tgggtttaga acttctggcg aagaaatttc tgaagggatt gaattttagg        60
     tcgaaagttg ccggtttagc aaaaaaggag cctgaaaata ttatcatgga ctcatcgggg       120
     gttgtaggaa gattaaccaa ttatttcaga ctttgtaata acctaagttt tgagccaaat       180
     cggtttgcaa agtaa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page