(data stored in ACNUC7421 zone)

EMBL: CP002157.PE622

CP002157.PE622       Location/Qualifiers
FT   CDS_pept        complement(664355..666295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01806"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01806"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99655"
FT                   /db_xref="GOA:A4AWP1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP1"
FT                   /protein_id="EAQ99655.1"
FT                   /translation="MSEEANKKNYSADSIQALEGMEHVRMRPSMYIGDVGVRGLHHLVY
FT                   EVVDNSIDEAMGGHCDRIDVTINEDNSITTRDNGRGIPVDLHKKEGVSALEVVMTKIGA
FT                   GGKFDKDSYKVSGGLHGVGVSCVNALSDHLKATVFRDGKIWEQEYERGKSLYPVKSVGE
FT                   TKERGTEVTFHPDTTIFTQTIEYSYETLSNRMRELSYLNKGVTISITDKRQKDEKGEFV
FT                   SESFVSTEGLKEFVRFLDGNREALTQGVISMEGEKNGIPVEVAMVYNTSYTENLHSYVN
FT                   NINTHEGGTHLSGFRRGLTSTLKKYADASGMLDKLKFEVQGDDFREGLTAIVSVKVAEP
FT                   QFEGQTKTKLGNREVSSAVSQSVSEMLTNYLEEHPDDAKIIVQKVILAAQARHAATKAR
FT                   EMVQRKTVMSIGGLPGKLSDCSDQDPVNCEVFLVEGDSAGGTAKQGRDRNFQAILPLRG
FT                   KILNVEKAMQHKVFENEEIKNIYTALGVTIGTEEDSKALNLEKLRYHKVVIMCDADVDG
FT                   SHIETLILTFFFRYMRELIENGHVYIATPPLYLVKKGSKKRYAWSDEERDEIAESFNGS
FT                   VGIQRYKGLGEMNAEQLWDTTMNPEFRTLRQITIDNATESDRVFSMLMGDEVPPRREFI
FT                   EKNAVYANIDA"
     atgagcgaag aagcaaataa aaagaattat tcggccgata gtattcaggc acttgaaggg        60
     atggagcatg ttagaatgcg accttcaatg tatatcggtg acgttggtgt tcgaggattg       120
     caccatttgg tttatgaagt ggttgacaat tcaatcgatg aggcaatggg aggacattgc       180
     gataggatcg atgtgaccat taatgaggac aattctatta caactagaga taatggccgg       240
     ggaattccgg ttgatttaca taaaaaagaa ggcgtatctg cactagaggt tgttatgacc       300
     aagattggcg caggtggtaa atttgataag gattcctata aagtgtctgg tggtttgcac       360
     ggggttgggg tttcctgtgt gaatgcactg tcagaccatc ttaaagctac agttttcaga       420
     gatggtaaga tctgggagca agaatacgaa aggggtaaat ctctttatcc tgttaaaagt       480
     gttggggaaa cgaaggaaag aggaactgag gttacttttc atccagacac caccatattt       540
     acccaaacca tagaatatag ttatgaaact ttgtcaaata gaatgcgtga gctttcgtat       600
     ttgaataaag gggtaaccat ttctattact gataaacgac aaaaagacga aaaaggagaa       660
     tttgttagtg aatcttttgt ctccaccgaa ggcttaaagg aatttgttcg gtttttggat       720
     ggtaatcgag aagcattgac ccaaggggtt atctctatgg aaggagagaa aaatggaatt       780
     ccggttgaag tggcaatggt gtataatacc tcttatactg agaaccttca ttcttatgtg       840
     aacaatatca atacccatga gggaggtaca catttgtcag gtttcagaag aggattaaca       900
     agcaccttga agaagtatgc cgatgcttca ggaatgttag ataaactaaa atttgaagtc       960
     caaggagatg actttagaga gggattaact gctattgtat cggttaaggt agctgaaccc      1020
     caatttgaag gccaaaccaa gacaaaattg ggtaataggg aggtttcttc agcagttagt      1080
     caatctgtgt ccgaaatgtt gactaattac ttggaagaac acccagacga tgctaaaata      1140
     atagtccaaa aagtaatttt ggctgcacaa gcaagacatg ctgctactaa ggctcgtgaa      1200
     atggtgcagc gtaaaacggt aatgagtatt ggtggcttgc caggaaaatt atccgattgc      1260
     tccgatcaag atccggttaa ctgtgaggta ttcctggttg agggagattc ggccggaggt      1320
     acggccaaac aaggacgtga tagaaacttt caggcaattt taccgcttag aggtaagatt      1380
     ctgaatgtgg aaaaagcaat gcagcataag gtttttgaaa atgaagaaat caagaatatt      1440
     tatactgcgc ttggtgttac tattggtacc gaagaagata gtaaagcatt gaaccttgaa      1500
     aaactgagat atcataaagt agttattatg tgtgatgccg acgttgatgg tagccatatt      1560
     gaaacattga ttctgacttt cttcttccgt tatatgaggg aactgattga aaatggacat      1620
     gtatatatag caactccacc tttgtacttg gttaaaaaag gaagtaaaaa acgttatgct      1680
     tggtcagatg aggagcgtga tgaaattgcc gagagcttta atggtagtgt tgggattcag      1740
     cgttacaaag gtcttgggga aatgaacgca gaacaattat gggataccac gatgaaccct      1800
     gagtttagaa cgctccgaca aataactatt gataatgcca ctgaatctga tagggtattc      1860
     tctatgttaa tgggagatga agtacctcca agaagggaat ttattgagaa aaatgccgtt      1920
     tatgcgaaca ttgatgcata a                                                1941
//

If you have problems or comments...

PBIL Back to PBIL home page