(data stored in ACNUC7421 zone)

EMBL: CP002157.PE624

CP002157.PE624       Location/Qualifiers
FT   CDS_pept        668447..669034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01816"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01816"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99657"
FT                   /db_xref="InterPro:IPR021314"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP3"
FT                   /protein_id="EAQ99657.1"
FT                   /translation="MNVLLLRFELQKTNTIMKNLFALSILMLALVFTTNVSAQKFSGLD
FT                   KSPMDMATYPSSYKIADKAVRVTYSRPQLKGRSVSELAPAGEVWRTGANEAVEITLYKD
FT                   AKIGDADVKAGTYSLFTIPGKNEWTVILNNNLNQWGAYSYSKKADVARAQAKASTDSES
FT                   LDAFSIAFKEVEGGAHLVMAWGTTRVSLPIMM"
     atgaatgtat tactacttag atttgaatta caaaaaacaa acacaattat gaaaaattta        60
     tttgcacttt ctattttaat gctagccttg gtattcacta caaatgtttc tgcccaaaaa       120
     ttcagtggtt tggacaaaag tccgatggat atggccacat acccatctag ctacaaaata       180
     gccgataaag ctgttagggt aacctatagt agacctcaat taaaaggacg atccgtttct       240
     gaattagctc ctgcgggaga agtttggaga accggtgcca atgaagctgt tgaaatcacg       300
     ttgtataaag atgcaaaaat cggtgatgca gatgtaaagg cgggtactta ttcactattt       360
     accattcctg gcaaaaacga atggacggta attttaaaca ataacctaaa ccaatgggga       420
     gcttattctt atagtaaaaa agctgatgtt gccagagcac aggcaaaggc aagcactgat       480
     tctgaatctc ttgatgcctt ctcaattgct tttaaagaag ttgagggagg tgcacatttg       540
     gtaatggcat ggggaaccac tagagtttct cttcctatta tgatgtag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page