(data stored in ACNUC7421 zone)

EMBL: CP002157.PE627

CP002157.PE627       Location/Qualifiers
FT   CDS_pept        complement(671280..672047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01831"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99660"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP6"
FT                   /protein_id="EAQ99660.1"
FT                   /translation="MMDVNFAVLIDGDNIPSANVKEMMEEIAKYGNPTIKRIYGDWTNP
FT                   RLNKWKAVLLENAITPIQQYGYTSGKNATDSAMIIDAMDILYSGKVNGFCLVSSDSDFT
FT                   RLATRLREAGMQVFGIGEKKTPDPFIVACDKFIYIEILKNQSEETSVNTDDEKSKGQNT
FT                   IDKITTKEIRFITSTITDVADDDGWAFLGDVGSLLQKRHPNFDSRNYGFQKLTPLIGSI
FT                   KNFELERREDSRGRKKLIYVKIKENRSSKPRKK"
     atgatggatg taaactttgc agtacttatt gatggtgaca atattccttc cgctaatgta        60
     aaagagatga tggaagaaat tgccaaatac ggtaacccta ccataaagcg catttatggt       120
     gactggacaa atccgcgcct taacaaatgg aaggctgttc ttttggaaaa tgccattact       180
     cccatacaac aatacggtta taccagcggt aagaacgcca cggattctgc tatgatcatc       240
     gatgccatgg atattttgta ttcgggcaag gtaaatggtt tttgtttagt aagtagtgac       300
     agtgacttta cacgtttggc aacacggtta cgtgaagccg gaatgcaggt ttttggcatt       360
     ggtgagaaga aaacacccga tccgttcatt gtggcttgcg acaaattcat ttatatagag       420
     attcttaaga atcagtccga ggagacctca gtaaatactg atgatgaaaa gtccaaaggc       480
     cagaatacca ttgataagat tacaacaaag gaaattcgtt ttataacaag cacaataacc       540
     gatgttgcag atgatgatgg ttgggcgttt ttaggtgatg ttgggagctt gttgcaaaaa       600
     agacatccaa attttgattc aagaaactat ggttttcaga aacttacacc gctaataggg       660
     tctataaaga attttgaatt ggaacgtcgt gaggattccc gtggtcggaa aaagctgatt       720
     tatgtgaaaa tcaaggaaaa cagatcttct aaaccccgaa agaaataa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page