(data stored in ACNUC7421 zone)

EMBL: CP002157.PE631

CP002157.PE631       Location/Qualifiers
FT   CDS_pept        complement(677045..678349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01861"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01861"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99666"
FT                   /db_xref="GOA:A4AWQ2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ2"
FT                   /protein_id="EAQ99666.1"
FT                   /translation="MSRPNRFSIVNPSKSPVFYGYVVLVIGTIGIYFSIPGQTIGVSVF
FT                   TDPVKDALGLSRNQFSNSYMIGTILSALVIGRAGIWFDKYGARYVAFFAALTLAFSLWL
FT                   CSWSANMSNFIKEFLNLDSWTVPFVLMTILFFMLRFSGQGVLTMASRNMIMIWFDKNRG
FT                   KVNAVSSVAISFGFSSSPLWIDYLIEGNSWEVTWKILALGLLVFSFFVLQLYKNRPEDH
FT                   GLLPDGASKVIEADVDSMALGKQFTLKEAKGTRAFWMYGLILAFNSFFITGLTFHVVSI
FT                   FASEGYPKSDAISIFLPGSVVAVTISTIFNFLSDYLQLKWYLYLMILGGIVASIGFLYL
FT                   PTPFGIPLLIAGFGIMGGFFAVLNAIVWPRFFGRNNLGAITGKIMGFLILASALAPPIF
FT                   SLCFSTFGSYKLLGYLGLTFMIFMAVGSLKADNPQ"
     atgtccaggc caaatcgttt ttcaattgtt aacccatcca aaagtcccgt cttttatggt        60
     tacgtggtat tggttatcgg tactattggt atttatttta gtattcctgg acaaacaata       120
     ggggtatctg tttttacgga cccagtgaag gatgcactag gcttatcgcg aaatcagttt       180
     agcaattctt acatgattgg cacgattcta agcgctttgg tcataggcag ggcgggtatc       240
     tggtttgata aatatggagc tcgttatgtt gctttttttg cggcgttgac cttggccttc       300
     tcactttggt tgtgctcctg gtcggccaat atgagcaatt ttataaagga attcttgaac       360
     ttggattctt ggacggtacc tttcgttctc atgaccatac ttttttttat gcttcgtttt       420
     tctggacagg gtgtattgac catggcctca cgaaatatga ttatgatctg gttcgataag       480
     aataggggaa aggtcaatgc tgtaagtagt gttgccattt catttggatt ttcatcatca       540
     cctttgtgga ttgattattt gatagaagga aatagttggg aagtcacctg gaaaatcttg       600
     gcattgggtc ttttagtatt tagttttttt gtgttgcaat tatacaagaa tagaccagaa       660
     gatcacggtc tattacctga tggagcttcg aaagtaattg aagctgatgt tgattcaatg       720
     gctctaggaa agcaattcac gctaaaagaa gcaaaaggaa cccgtgcttt ttggatgtac       780
     gggttaatcc tggcctttaa tagttttttt ataacaggtc ttacgtttca cgtcgtatct       840
     attttcgcca gtgaaggtta tccaaaatca gatgctattt caatattttt gccagggtcg       900
     gtagtggcag taactatttc tacaatattt aattttttaa gcgattactt acaactaaaa       960
     tggtatttgt atttgatgat tttgggaggt atcgtagctt caattggttt cttgtattta      1020
     cccactccat ttggtatacc cttattaatt gccggctttg gaattatggg aggattcttt      1080
     gccgttctca acgccattgt ttggccccgg ttttttgggc ggaataacct tggtgccatt      1140
     acaggtaaga taatggggtt tctcatttta gcaagcgctt tggcacctcc tatctttagt      1200
     ttgtgttttt caacttttgg gtcgtataaa ctattgggct atttaggtct tactttcatg      1260
     atttttatgg cggtcggttc tttgaaagct gataatccac aatag                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page