(data stored in ACNUC7421 zone)

EMBL: CP002157.PE632

CP002157.PE632       Location/Qualifiers
FT   CDS_pept        678480..679271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01866"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01866"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99667"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ3"
FT                   /protein_id="EAQ99667.1"
FT                   /translation="MKINSFFKTLTLALFLLGTVTIIHAQNQQKEYYQLQTYTLANEKQ
FT                   ESMTDAYLKNAYLPALKRMGIQNVGVFKMHSNNYVLSNKIYVLIPFSSLDKLYGLEQDL
FT                   HKDELYNESGKEYILASYKQPPYERLNSTILLAFDDMPKMAPSKVEGSRKDRIYELRSY
FT                   ESPTKTIFKNKVDMFNAGGEVTLFEELGFNAVFYAEVLSGDKMPNLMYMTTFTNKESRD
FT                   KHWDAFRVAPKWKELSSMSKYQNNVSHIDITFLYPTEYSDY"
     atgaaaataa attccttctt caagacccta acattagcat tgttcttgct aggaactgta        60
     acaatcatcc acgctcaaaa tcaacaaaag gaatattatc agctccaaac atatactctt       120
     gcaaatgaga agcaggaatc aatgacggat gcttatttga aaaatgctta tttaccagca       180
     ctaaaaagaa tgggaattca gaatgttggc gtgtttaaaa tgcattcgaa caactatgtt       240
     ctatctaata aaatctatgt cttgattccg ttttcctctc tggacaaact ttacggcttg       300
     gaacaagact tgcacaaaga tgaattatac aatgaatcag gaaaagaata cattttggca       360
     tcttataaac agccacccta tgaaagattg aattcaacta tcttgttggc ttttgatgat       420
     atgccaaaaa tggctccttc aaaagtcgaa ggatcaagaa aagatagaat atacgagtta       480
     aggagttatg agtcgccaac gaagactatt ttcaaaaata aagttgatat gttcaacgcg       540
     ggaggtgaag tcactctttt tgaggaatta ggatttaatg cagtttttta tgcggaagtg       600
     ctttcaggag acaaaatgcc caatttaatg tacatgacca cctttacaaa taaagaaagc       660
     agagataaac attgggatgc ttttagagtt gccccaaaat ggaaagagtt atcttcaatg       720
     tctaaatacc aaaataatgt ttctcatata gacattacat tcctatatcc tacggagtat       780
     tctgactatt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page