(data stored in ACNUC7421 zone)

EMBL: CP002157.PE636

CP002157.PE636       Location/Qualifiers
FT   CDS_pept        685621..686304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01886"
FT                   /product="Cell division ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01886"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99671"
FT                   /db_xref="GOA:A4AWQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ7"
FT                   /protein_id="EAQ99671.1"
FT                   /translation="MSESILELKDVGVFQKESMVLNEVSLDIKKGEFVYLIGKTGSGKS
FT                   SFMKTLYGDLPLRQGTGTIVGFDLEKLKEKDIPFLRRKLGIVFQDFKLLPDRNINNNLQ
FT                   FVLKATGWKDQIKMNNQIAEVLDKVGMKTKGFKFPHELSGGEQQRIAIARALLNDPELI
FT                   LADEPTGNLDPQTSVEVMKVLQEINQSGRTILMATHDYALILKYPSKTLKCDGSKVFEV
FT                   VQKAV"
     atgtccgaat ccattttaga attaaaagat gtgggtgttt tccaaaagga aagcatggta        60
     ttgaatgagg ttagtttgga tataaagaaa ggggaatttg tttatctgat cgggaaaacc       120
     ggtagtggca aaagtagttt tatgaaaacc ctttatggtg atctaccttt gaggcaagga       180
     actggaacaa ttgttggttt tgacctggaa aaactaaaag aaaaagacat tcctttttta       240
     agaagaaagt taggcattgt ttttcaagac tttaagcttc ttcctgatag aaacataaac       300
     aacaatcttc aatttgtact caaagcaact ggatggaagg accagattaa aatgaataac       360
     cagattgccg aggttctgga taaagttggt atgaaaacca agggttttaa atttccccat       420
     gaattatctg gaggagaaca acagcgcata gcaatagcac gggcgctact aaatgaccct       480
     gaactcatct tggcagatga gcctacaggg aatcttgacc cccaaactag tgttgaagta       540
     atgaaagtgc ttcaagaaat aaatcaatca ggaagaacta tactcatggc aacccatgat       600
     tatgcactta tcctaaaata cccttccaaa acactcaaat gtgatggtag taaggttttt       660
     gaggtagttc agaaagcagt ttag                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page