(data stored in ACNUC7421 zone)

EMBL: CP002157.PE638

CP002157.PE638       Location/Qualifiers
FT   CDS_pept        687739..689244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01896"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01896"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99673"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ9"
FT                   /protein_id="EAQ99673.1"
FT                   /translation="MPQFEYEGFKYANYPFAHLYKDDNGHKGEKKIHQIIFGDWVGVLK
FT                   PKKTDGDYVLVRVRGENGWMHKDALLDERVLEIVFMDVGQGDGALIVTPDDEHIIVDAG
FT                   LGDNMWRFLKWRYNEFKTEWTFKYAIASHPDQDHYGGYHYLAGEPNVFFENYLHNGLLE
FT                   YQKDVKSSYFGDSVITDRTYYTELFDSKQKVFDFLIHEPNWKHPTGREQWDKKYAKLLK
FT                   RMLDNNKIKGEIKMVTEGDKYLKGFEQHKPLNIQILGPITEDIGGQKALRSLGNKGKTK
FT                   NGHSIVFKLNYKDINIFLGGDLNIKAEEFLLKEHTGETLEFNSAIEENEFIESARNIFE
FT                   ADVSKACHHGSADFTSLFLKCLNSIATVISSGDEEQHSHPRPDTLGAIGVNGRGDRPLI
FT                   FSTELARSHREDEKKTLDEISELEIKLATATTNAKRLKLIDQIQEKNDKLKERNVTVYG
FT                   SINLRTDGERCIIAQKLEKGGGSKVWDIYKLEKNSLGRFKYVP"
     atgccacaat ttgaatatga gggttttaaa tatgccaatt acccttttgc acatttatat        60
     aaagatgaca atggccataa aggagaaaag aaaatacacc aaataatttt tggtgactgg       120
     gtcggtgtcc tcaaaccaaa aaagactgat ggtgattatg ttttggtaag agttcgtggt       180
     gaaaacggat ggatgcacaa agatgccctt ctagatgaac gcgttcttga aattgtattt       240
     atggatgtag ggcaaggtga tggagcattg atagtgactc cagacgatga acatattatc       300
     gttgacgccg gtttaggtga taacatgtgg cgtttcttaa aatggcgata taatgaattc       360
     aagactgaat ggactttcaa atacgcaata gctagtcacc ctgatcaaga tcattatggt       420
     ggttatcatt atttggcggg ggaacccaat gtttttttcg aaaactatct acataatggc       480
     cttttggaat atcaaaaaga tgtgaagtcc tcctattttg gtgattcggt aattaccgat       540
     cgtacgtatt acactgaatt gttcgatagt aagcaaaaag tatttgactt tctaattcat       600
     gaacccaatt ggaaacatcc cacaggaaga gagcaatggg ataaaaagta cgccaaactc       660
     cttaaacgca tgctagataa caacaaaata aagggagaaa taaagatggt tactgaaggc       720
     gataaatatc tgaaaggttt tgaacagcac aaacccctga acattcaaat acttggaccc       780
     attacagaag atattggtgg gcaaaaagca ctaagatcct taggtaacaa gggaaagacc       840
     aaaaacggac attcgatagt atttaaactt aactataagg acataaatat atttctgggt       900
     ggtgatttaa atatcaaagc agaagagttt cttctaaaag aacatactgg tgaaacttta       960
     gagtttaatt ctgcgataga agagaacgaa tttattgaaa gtgcccgtaa tatttttgaa      1020
     gctgacgtct caaaagcctg tcatcatggt agtgctgatt tcacaagctt attcttaaaa      1080
     tgtctaaatt ccatcgcaac ggttatttcc agtggcgacg aagaacaaca ttcccaccct      1140
     aggccagata cgttaggggc aattggcgtg aacggtagag gtgacagacc attgatattc      1200
     agcactgaat tggcccgttc acatagagaa gatgaaaaaa agaccttgga tgaaatctca      1260
     gagctggaaa taaaactggc gaccgctaca actaatgcca aacgcctgaa actaatagat      1320
     cagatacagg aaaaaaatga caagcttaag gagcgaaatg taaccgtata tggttcgata      1380
     aacctaagaa ctgatggcga acggtgcatc atcgctcaaa aactggaaaa aggcggtggc      1440
     agcaaagttt gggatattta caaattagaa aagaatagct taggccgttt taaatatgtt      1500
     ccttag                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page