(data stored in ACNUC7421 zone)

EMBL: CP002157.PE64

CP002157.PE64        Location/Qualifiers
FT   CDS_pept        complement(75674..76264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16451"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00693"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC3"
FT                   /protein_id="EAR00693.1"
FT                   /translation="MKLFLFFALLLLVLPVNAQEEVEILPAEIQIKTAVLPAPEADQKG
FT                   AMVYGYNDKGEMVVLREGTNNLICIGDNPNKEGVSVSCYSSKLAVFMARGRELSAEGKD
FT                   FKEKREIRGAEVASGKIPMPRDPSMTYIFYGKDENYDKSTGELKDGQFRYVIYTPFATP
FT                   ESTGLPIKPHAKGMPWLMDPGTHRAHIMVGPFN"
     atgaaactat tcttattttt tgctcttttg cttcttgtgc ttcctgttaa tgctcaagaa        60
     gaagttgaaa ttctcccagc tgaaatacaa ataaaaacgg cagtgctacc agcaccagaa       120
     gctgaccaaa aaggtgctat ggtatatggg tataatgaca agggtgaaat ggttgtactt       180
     cgtgaaggca ccaataattt gatatgtatt ggagacaacc ccaataaaga aggcgtgagt       240
     gtttcttgtt actctagtaa actagcagtt tttatggccc gcgggcgtga actttctgct       300
     gagggtaaag actttaaaga aaagcgtgaa attagaggtg ctgaggttgc ttctggaaaa       360
     attcctatgc caagggatcc cagcatgacc tatattttct atgggaagga cgaaaactac       420
     gataaatcca ccggggagct aaaagatggg caatttagat atgtgatcta tacccctttt       480
     gctactccag aatcaacagg attaccaatt aagcctcacg caaaaggaat gccatggtta       540
     atggatccag gaacgcatag ggcccatata atggtcggtc ctttcaatta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page