(data stored in ACNUC7421 zone)

EMBL: CP002157.PE641

CP002157.PE641       Location/Qualifiers
FT   CDS_pept        complement(690562..692289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01911"
FT                   /product="GTP-binding elongation factor family protein
FT                   TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01911"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99676"
FT                   /db_xref="GOA:A4AWR2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR2"
FT                   /protein_id="EAQ99676.1"
FT                   /translation="MHHCELFRENEKTGELILDNNDLERERGITIVSKNVSVTYKDTKI
FT                   NIIDTPGHADFGGEVERVLNMADGVLLLVDAFEGPMPQTRFVLQKAIDLGLKPCVVINK
FT                   VDKENCTPEEVHEKVFDLMFELGAEEWQLDFPTVYGSAKHNWMSEDWQNETDSIEPLLE
FT                   MVIEHVPSFHAQEGNTQMLITSLDFSSFTGRIAIGRLQRGSLKEGQQVSLVKRDGSIVK
FT                   SKIKELFTFEGLGRIKVKEVATGDICAIIGLEGFDIGDTIADLENPEGLKTIAIDEPTM
FT                   SMLFTINDSPFFGQDGKFVTSRHIKERLEKELEKNLALRVEETDSADKFMVFGRGVLHL
FT                   SVLIETMRREGYELQIGQPQVIIREFDGVKCEPIEHLTIDLPEEVSGKAVEMVSIRKGE
FT                   MTSMEAKGNRMLCEFIIPSRGIIGLRNQLLTATAGEAIMAHRFFEYQPLKGNIPQRQNG
FT                   SLVSMEKGKAIPYSIDKLQDRGKFFVDPGEDIYEGQVIGENSRGDDMTINITKTKKLSN
FT                   VRSAGADDKAKIVPAIKFSLEEALEYIQKDEYVEVTPKFLRLRKIYLTEVDRKRNKIA"
     atgcaccatt gtgaactgtt tcgtgagaat gaaaagaccg gtgaattaat tttggataac        60
     aatgatttgg aacgcgaacg cggaattacc attgtttcta aaaatgtgtc tgtaacctat       120
     aaggatacta aaatcaatat tattgatact cctggtcacg ccgattttgg tggcgaagtt       180
     gagcgtgttt taaatatggc cgatggtgtt cttttgttag ttgatgcttt tgaaggccca       240
     atgccacaaa ccaggttcgt tttacaaaag gcaattgatt taggattgaa accatgtgtg       300
     gttattaaca aggttgataa agaaaattgc acacctgagg aagttcatga aaaagtattt       360
     gatttgatgt tcgaattggg tgctgaggaa tggcaattgg attttcctac cgtttatgga       420
     tcagccaagc ataattggat gagcgaggat tggcagaacg aaacagattc cattgaacca       480
     ttgttggaaa tggtaattga acatgttccc tcatttcatg ctcaagaagg taatacccaa       540
     atgcttatta cttccttgga tttttcttcc tttacaggaa gaatagctat tggaagattg       600
     caacgtggta gcttaaaaga aggacaacag gtctctttgg taaaaaggga tggtagtatt       660
     gtaaaatcaa aaattaaaga actttttacg ttcgaaggcc ttggaagaat taaagtaaaa       720
     gaggttgcta ctggtgatat ttgtgcgatt ataggtttgg aaggttttga tattggtgac       780
     accatagccg acttggagaa ccctgaagga ttaaagacca ttgctattga tgagcctacg       840
     atgagcatgt tgtttaccat taatgatagt ccattttttg gacaggatgg taagttcgtt       900
     acttcaaggc atattaaaga acgtttagaa aaagaacttg aaaagaactt agcattacgt       960
     gttgaagaaa cagatagtgc agataagttt atggtttttg gccgtggagt attacacctt      1020
     tcagtattga ttgagacgat gagaagggaa gggtatgaac tacaaatagg tcaacctcaa      1080
     gttatcatta gagagttcga tggagttaaa tgcgaaccta tagaacattt gaccattgat      1140
     ttaccagaag aagtttctgg aaaagctgtt gagatggtgt caatccgaaa aggtgaaatg      1200
     accagtatgg aggctaaggg gaatcgtatg ctttgcgagt tcattattcc gtcaagaggt      1260
     attataggcc tacgaaatca attattgaca gctactgctg gcgaggctat tatggcccac      1320
     cgattttttg aataccaacc tttgaaaggt aatattccac agcgtcaaaa cggttctttg      1380
     gtttctatgg agaaaggaaa agcaatacct tactctattg ataaattgca ggatagaggc      1440
     aagttctttg ttgatccagg cgaggatatt tatgaaggtc aggttattgg agagaattct      1500
     cgtggagatg acatgaccat aaatattacg aagactaaga aattatccaa cgttcgttcg      1560
     gcaggagcag atgataaggc taaaattgta ccggcaatca aattctcttt ggaggaagct      1620
     ctggaatata ttcaaaagga tgagtatgtg gaggtaacgc ccaaattttt acgactacgt      1680
     aaaatttatt taacggaagt tgatcgaaag cgaaataaaa ttgcctag                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page