(data stored in ACNUC7421 zone)

EMBL: CP002157.PE648

CP002157.PE648       Location/Qualifiers
FT   CDS_pept        699224..699832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01946"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01946"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99683"
FT                   /db_xref="GOA:A4AWR9"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR9"
FT                   /protein_id="EAQ99683.1"
FT                   /translation="MESKNYLKDLSEIKDLMSKSSRFISLSGLSGVLAGIYALIGATIT
FT                   YWLVTTYSNGTLLLDGWIFRTSLLILCCVAGLSILTGIYLTTRKAKKNGEKIWDASSKR
FT                   LIVNFMIPMITGGLYIIIILSQQKYGQAGALMLIFYGLALINAAKYSIGNIRYLGYIEI
FT                   ILGLICALVPGYGFWLWVFGFGIMHIIYGSVMYFKYEKK"
     atggaatcaa aaaactattt aaaagacctc agtgagataa aagatctcat gagcaagtca        60
     tctcgcttta tatcattaag tggcctctct ggagtattgg ccggtattta cgccttaatt       120
     ggtgctacca taacgtattg gttggtaacc acctatagca acggaacctt acttttggat       180
     ggatggattt tcagaacctc actactcatt ttatgctgtg tagctgggct aagtatacta       240
     acgggtattt atttaaccac tcgaaaagcc aagaaaaatg gagaaaaaat atgggacgcc       300
     tcatcaaaaa ggttaattgt aaatttcatg attcctatga taaccggtgg cttatatata       360
     attataatat taagtcagca aaagtatggc caagctggag cgttaatgct tatattttac       420
     ggtctcgctt taattaatgc agctaaatac agcattggca acattcgtta cttagggtat       480
     attgagatta tactgggcct tatatgcgca ctggttcctg ggtacggttt ttggttatgg       540
     gtatttggct ttggcattat gcacatcata tacggatcgg taatgtattt taagtacgag       600
     aaaaaatag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page