(data stored in ACNUC7421 zone)

EMBL: CP002157.PE649

CP002157.PE649       Location/Qualifiers
FT   CDS_pept        699892..700131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01951"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01951"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99684"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS0"
FT                   /protein_id="EAQ99684.1"
FT                   /translation="MSILMVNEYAEFTTLKELLEVTDGNLASHIKALEKGTYLEVKKQF
FT                   IGNKPNTRYTITPLGRNAFQKHISALENLIKQQE"
     atgtctattc ttatggtaaa tgaatatgcg gaatttacaa ctttgaaaga gttattggaa        60
     gttactgatg gtaatctcgc aagtcatata aaggcgctgg aaaaaggcac ctatttagag       120
     gtgaaaaagc aatttattgg taacaagcca aataccagat atacaattac gccgttggga       180
     agaaacgctt tccaaaaaca tattagtgcc ctcgaaaatt taattaagca acaagaataa       240
//

If you have problems or comments...

PBIL Back to PBIL home page