(data stored in ACNUC7421 zone)

EMBL: CP002157.PE650

CP002157.PE650       Location/Qualifiers
FT   CDS_pept        700181..701527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01956"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01956"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99685"
FT                   /db_xref="GOA:A4AWS1"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS1"
FT                   /protein_id="EAQ99685.1"
FT                   /translation="METKKQKIGNWFRTSISAKMFVVGFILLILLIPLSYVKDLIRERE
FT                   IRQSEVIQEINEKWGNEVILYGPILRIPYKTYREEKTFDDKTKTFIKTYEEIINHGYFL
FT                   PNKLNIDSGVKSKQLERGIYESVVYTADVKMQGSFSIFDFSSKDIPQEDILWDKTTLLF
FT                   KTSNLKGIRNELKVQLNDAEYTLKPKFDEEYMSTLESGYIQKLKDQSSASTFDLNLRIN
FT                   GSEGLRFIPIGAETTVHMASDWHSPSFNGNYLPNDETKKITNNGFKADWKVLETNRQFG
FT                   QQFFNNLPNLNKYSFGTNLIIPIDDYQKTERTSKYGLMIIGLTLLVFLLIQIISKIPIH
FT                   PFQYFMIGLALVMFYTLLISISEHQNFLIAYLIAGISVVGLITTYSKTILKNKKFPLLI
FT                   FGSLTALYAFIFVIIQLENYALLVGSIGLFIILAIIMFTSKKIDWANNN"
     atggaaacaa aaaagcaaaa aatcggaaac tggttcagaa catccatctc agccaaaatg        60
     tttgtagtag ggtttattct tctaattctt ttgataccct tgagttatgt caaagattta       120
     atcagggagc gagaaatacg gcaatccgaa gtaattcagg aaataaatga gaaatggggt       180
     aatgaagtaa ttttatatgg ccctatactt agaattcctt ataaaactta tcgcgaagaa       240
     aaaacatttg atgacaaaac caaaaccttc ataaaaacat atgaagagat aatcaaccat       300
     gggtactttt taccaaataa actgaacata gattctggtg tcaaaagtaa acaactggaa       360
     cgtggaattt atgaatcggt tgtatatacg gcagatgtta aaatgcaagg gagtttttcg       420
     atctttgatt tttcctccaa agacattccc caagaagata tcctttggga taaaacaact       480
     ttactattta aaacctcaaa cttaaaagga attcgtaatg agttaaaggt tcaattgaat       540
     gatgccgaat acactttgaa acctaaattc gatgaagaat atatgagtac tctggaatcg       600
     gggtatattc aaaaacttaa ggatcaaagt tccgcttcaa cattcgacct gaatttaaga       660
     atcaatggaa gcgaaggact acgatttatt cccattggag ccgaaaccac tgttcatatg       720
     gcttcagatt ggcattctcc aagtttcaat ggaaattatc tgccgaatga tgaaaccaag       780
     aaaataacaa acaacggatt taaagctgat tggaaggtcc ttgaaacaaa ccgtcaattt       840
     ggtcaacagt tcttcaacaa tcttcccaat ttgaacaaat actcttttgg caccaatttg       900
     atcattccca tagatgacta tcaaaaaacc gaacgtacaa gcaagtacgg tcttatgatc       960
     attggtctta cccttttggt tttcttgttg attcagatta ttagcaaaat ccccatacac      1020
     ccatttcaat attttatgat aggattggct ttggtcatgt tctatactct gcttatctct      1080
     atttccgaac atcaaaactt tttaatcgcc tatttaatcg ccggaatttc agtagttggt      1140
     ttaataacga cctattcgaa aaccatttta aagaacaaga aatttccact tctcattttt      1200
     ggttctttaa ccgcgctata tgccttcatt tttgtcatca ttcaattaga gaactatgca      1260
     ttattagtgg gcagtatagg actgttcatc atccttgcca ttatcatgtt cacctcaaag      1320
     aaaatcgatt gggcaaataa taattaa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page