(data stored in ACNUC7421 zone)

EMBL: CP002157.PE651

CP002157.PE651       Location/Qualifiers
FT   CDS_pept        complement(701595..702800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01970"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99686"
FT                   /db_xref="GOA:A4AWS2"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR027281"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS2"
FT                   /protein_id="EAQ99686.2"
FT                   /translation="MRFGIIRERKNPPDRRVVLSPEACQKVLSTYDKAQITVEPSPIRV
FT                   FTNEEYKEAEIEVASKMKECDVLLGVKEVPIKNLIPSKKYFFFSHTIKKQPYNRKLLRA
FT                   ILDKNIEMYDHEVITNEKGIRLVAFGRYAGVVGAYNGFRAYGLKNGLYKMPKAEKLTDQ
FT                   QALIAELSGIKLSNIKILLTGRGRVGNGAREMLDGMGMRKVNVHEFLDEEFNEPVYCQI
FT                   DASDYNKRKDGVRGNKADFFANPEEYRSNFFRFTKVADFYIAGHFHGDGAPFLFTREDA
FT                   KQPEFRINTVADISCDIDGPVASTLRASTIADPIYGYDPQSETETNFKNKRAIAVMAVD
FT                   NLPAELPRDASGGFGEAFVKYVIPAFFDKDTHGILKRARMTKNGKLTKRYAYLQDYVDG
FT                   KE"
     atgcgattcg gaatcatacg agaacgtaaa aatccaccag ataggcgagt agtgctatca        60
     ccagaggcct gtcaaaaagt cctttcaaca tatgataaag cccaaataac ggtggaacct       120
     tcaccaatac gggtttttac caatgaagaa tataaagagg ccgaaattga agttgcttca       180
     aagatgaaag aatgtgatgt gctattgggg gttaaggaag tcccaattaa gaatttgatt       240
     cctagtaaaa aatacttttt cttttcacat accattaaaa aacagcccta taataggaag       300
     ttgttaaggg ctattctaga taagaatata gaaatgtatg accatgaggt catcaccaat       360
     gaaaaaggta ttcggttggt tgcctttggt aggtatgccg gtgtagtggg ggcctataat       420
     ggttttcgtg cttatggatt aaaaaacgga ctttataaaa tgccaaaggc agaaaaattg       480
     actgaccaac aggcattgat agctgaactt tcgggaatca agttatcgaa tatcaagatt       540
     ctattgacag gtaggggtag agttggtaat ggtgctcgtg aaatgttgga tggtatgggc       600
     atgagaaagg tgaatgtgca tgaattttta gatgaggaat tcaatgaacc agtttattgt       660
     caaatagatg cctcagatta taataagcgt aaagacggag ttcggggaaa taaagctgat       720
     ttctttgcta atccagaaga atatagatcc aatttctttc gttttacaaa agtggccgat       780
     ttctatatcg caggtcactt tcatggcgat ggagcacctt ttctcttcac cagggaagat       840
     gcaaaacaac ctgagtttag aataaatacg gtggcagata tcagttgtga tattgatggg       900
     cctgtggcaa gtaccttgag ggcttcgact attgccgacc caatatatgg atatgatcct       960
     caatcagaaa cagaaaccaa cttcaaaaat aaaagggcca ttgctgtaat ggcggtggat      1020
     aatcttccag cagaattgcc tcgagacgcc agtggtggtt ttggagaagc atttgtcaaa      1080
     tatgtaatac ccgctttttt tgataaggat acacacggaa ttctcaaaag agcccgtatg      1140
     accaaaaatg ggaagcttac taaaagatat gcctatctcc aggattatgt tgatggaaag      1200
     gagtaa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page