(data stored in ACNUC7421 zone)

EMBL: CP002157.PE656

CP002157.PE656       Location/Qualifiers
FT   CDS_pept        710065..712188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01995"
FT                   /product="DNA-methyltransferase, type I
FT                   restriction-modification enzyme subunit M"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01995"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02016"
FT                   /db_xref="GOA:A4ALZ4"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ4"
FT                   /protein_id="EAR02016.1"
FT                   /translation="MSFEQTFKNIDDLLYKDSGADSELDYIGQTSWVMFLRYLDELEQD
FT                   KADEAELKGEEYKFILDEEYRWPIWAMPKDDDGKLDYHKAMTGPDLVQFVDRKLFPYLA
FT                   EFKQKADNPKTIEYKIGEIFSELKNKIKSGYNLREILEYADELPFRASTDKHELSHLYE
FT                   SKIKNMGNAGRNGGQYYTPRPLIRAMINVIDPQIGEKIYDGAAGSCGFLCETYEYMYER
FT                   MEKTTGNLKTLQEETLYGKEKKNLAYVIGVMNMILHGIEAPNIIHTNTLGENVRDIQEK
FT                   NRYHVILANPPFGGKERKEVQQNFDIKTGETASLFLQHFIKSLKTGGRAAIVIKDSFLS
FT                   NNTEKAYSTLRKNLLGSCELNCILDLPRGTFYGAGVKTVVLFFTKGAPTKKIWYYKLDP
FT                   KRTLGKTKPLNDNDFKDFLEKIRNKEIGKNSWIIKAHEIDENTCNLTPINPNEEKLDKI
FT                   LSPNTIISAVSKYSMDFNSELQKIKTNIDSYLSEVNLMLKNEGGIWKEERFGDVCEFVR
FT                   GPFGGSLKKSIFVEKGIAVYEQQHAINNQFEHVRYYINQDKFNEMKRFELKSGDLIMSC
FT                   SGTMGKVAIVPKSFEKGIINQALLKLSPNPSIDVNFLKYWMESKVFKLKIEELSMGAAI
FT                   KNVASVKILKEIMVPIPPIEIQKRIIQRIDSLVNSFEDAILITRNQLNHLEDLGESLLQ
FT                   ETFEASIEELESA"
     atgagtttcg aacaaacttt taaaaatata gatgacctgc tttacaaaga ttcaggagca        60
     gatagcgaat tagattacat aggacaaacc tcttgggtta tgttcttgcg ttatttagac       120
     gaactggaac aagacaaagc agacgaagcg gaattaaaag gcgaagaata caaattcatt       180
     ttagatgaag aataccgttg gccaatttgg gcaatgccaa aagatgatga cggaaaatta       240
     gactaccaca aggctatgac aggaccagat ttggttcagt ttgtagacag aaagttattt       300
     ccttacttgg cagagttcaa acaaaaagct gacaacccaa aaactattga atacaagatt       360
     ggcgaaatat tctctgaact gaaaaacaaa attaaaagcg gttataactt acgagagatt       420
     ttagaatatg cagacgaact tccttttcga gcttctactg ataaacatga gttaagccac       480
     ttgtacgaaa gtaagattaa aaacatgggt aatgcaggtc gtaatggtgg acaatactac       540
     acaccaagac cgcttattcg tgccatgatt aatgtgattg acccacaaat tggagaaaaa       600
     atttatgatg gtgcagcagg ttcttgtggt ttcttatgcg aaacatacga atacatgtat       660
     gagcgcatgg aaaaaacaac cggcaatctt aaaactttac aagaggaaac actttatgga       720
     aaagagaaaa agaacttggc gtatgttatt ggggtcatga acatgattct tcacggcatt       780
     gaagccccaa acatcattca taccaatacg ctgggcgaaa atgttcgtga tatacaagag       840
     aagaatcgtt accatgttat tctagcgaat ccgccatttg gtggtaaaga aagaaaagaa       900
     gtacaacaaa attttgacat aaaaacggga gaaactgcat ctttgtttct acagcatttt       960
     attaaaagtt taaaaacagg tggacgagcg gcaatagtaa taaaagattc ttttttatct      1020
     aataatactg aaaaagcata ctcaacactt cggaaaaatc tacttggaag ttgcgagtta      1080
     aattgtattc tcgatttgcc aagaggtaca ttttatggag caggagtcaa aactgtggtt      1140
     ttatttttta caaaaggggc tccaactaag aaaatatggt actataaact tgaccctaaa      1200
     agaactttag ggaaaacaaa acctcttaat gataatgatt ttaaagattt tcttgaaaaa      1260
     ataaggaata aagaaattgg taaaaactct tggataataa aagcccatga aatagatgag      1320
     aacacatgca atttaactcc aataaatcca aatgaggaaa agttagataa gatattaagc      1380
     cctaatacga ttatttctgc tgtaagcaag tactccatgg attttaattc agaacttcaa      1440
     aaaattaaaa ccaatatcga cagttatttg tcagaagtta atctaatgct aaaaaatgag      1500
     ggaggaatat ggaaagagga acgtttcggc gatgtttgtg aatttgtaag gggtcctttt      1560
     ggcggtagtt taaaaaaatc aatttttgtt gaaaagggaa ttgcagttta tgaacaacaa      1620
     catgcaataa ataaccaatt tgaacatgta agatattaca taaatcaaga taagttcaat      1680
     gaaatgaaaa gatttgaact taaatcaggt gacttaataa tgagttgttc gggcacaatg      1740
     ggtaaggttg ctattgtccc taaatcattt gaaaaaggaa taataaatca ggctttatta      1800
     aaactatcac ctaatccttc aattgatgta aattttttga agtattggat ggaaagtaaa      1860
     gtattcaaac taaaaattga agaactatca atgggtgcag caattaagaa tgtagcttct      1920
     gtgaaaattc taaaagaaat aatggtacct attcctccaa ttgaaataca aaagagaatt      1980
     attcaaagaa tcgattcttt agttaattct tttgaagatg caatactcat aacgcgtaat      2040
     cagcttaatc atttggaaga cctcggagag tctctactac aggaaacttt tgaagcaagt      2100
     attgaggaat tagaatctgc ttaa                                             2124
//

If you have problems or comments...

PBIL Back to PBIL home page