(data stored in ACNUC7421 zone)

EMBL: CP002157.PE657

CP002157.PE657       Location/Qualifiers
FT   CDS_pept        712191..714638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02000"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02000"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02017"
FT                   /db_xref="GOA:A4ALZ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ5"
FT                   /protein_id="EAR02017.1"
FT                   /translation="MNEAQTKHDLIEPALREAGWGIVKGSRLRLEFPITKGRLIGQNRR
FT                   SKPLFADYVLEYKNRRIGIVEAKKRDLYYTDGVGQAKDYAERLNIRFTYATNGLQIYGI
FT                   DLEECTEGDVSKYPTPDELWEMTYPTPKEDYKVEIANWKERLFAIPFEDRGGTWQPRYY
FT                   QQNAIAKVLEAISEKKDRILLTLATGTGKTAIAFQIAWKLFHAKWNLRRDASRSPRILF
FT                   LADRNILADQAFNSFNAFDTIDENIKVRIRPSEIKKKGTVPTNGSVFFTIFQTFMTDAQ
FT                   KNVDLEEVSEDVIPEIKKPEDFNFGQYPPDFFDLIVIDECHRGGGNDESSWRAIMDYFS
FT                   PAVQLGLTATPKRDVNGDTYNYFGDPVYTYKLKDGINDGFLTPFKVKEIQTNYDEYTVT
FT                   EDDTIIFGEAEVGDTFTYRDYGRKIIIQQVEEYRVKKFLEIINQNQKSLVFCATQKHAA
FT                   LIRDLINQNTDSKSTNYCHRVTADDGKMGELHLRDFQDNEKSIPTILTTSQKLSTGVDA
FT                   PEIRNIVLLRPVDSMVEFKQIVGRGTRLFDSKDYFTLFDFVNAHNHFQDPEWDGEPIPP
FT                   EPSTGGGTPRVCNICGETPCVCERPEPEPCPECDNIPCVCETPPRRMIKVKLSDNKVRE
FT                   IDSMVKTSFWSPSGKPISSQEFIEQLFGDLPSFFASENELRKIWSLPSTRKKLLNELSE
FT                   KGYTNSQLEDLRNLIHGEESDLFDVLSYVAYHKDLVPRLERAGKAKIQMNDYNPKQQEF
FT                   LNFVLEQYVKEGVDELDDAKLPNLLELKYQAIADAKNELGAIKSIRDTFIGFQELLYRD
FT                   RAM"
     atgaatgagg ctcaaaccaa acacgattta atagagcccg ctttgcgtga agcaggttgg        60
     ggcattgtta aaggtagtcg attgcgtttg gagtttccta ttaccaaagg tcgtttaatt       120
     ggtcaaaaca gacgttctaa accacttttt gctgattatg ttttagaata taaaaacaga       180
     agaataggta ttgtagaagc taaaaaaaga gatttatatt atacagatgg tgttggtcaa       240
     gccaaagact acgcagaacg tctaaatatt cgatttacgt acgccaccaa cggtttacaa       300
     atctatggta tagatttaga agaatgtaca gaaggtgatg tatctaaata cccaacacct       360
     gacgagcttt gggaaatgac gtacccaacg cctaaagaag attacaaagt tgagattgcc       420
     aattggaaag aacgcttatt tgcaattcct ttcgaagata gaggaggcac ttggcaacca       480
     agatattatc aacaaaatgc aatcgctaaa gtattagaag ctatttcaga gaagaaggac       540
     agaatcttgc tgactttagc aacaggaaca ggaaaaactg caattgcctt tcaaattgct       600
     tggaaattat ttcatgccaa atggaattta aggcgagatg catcaagaag tccaagaatc       660
     ttattcttag cagacagaaa tattttagca gaccaagcat ttaattcatt caatgctttt       720
     gataccattg atgaaaacat aaaggttcga atccgaccgt cggaaataaa aaagaaaggt       780
     acggtaccta caaatgggag tgttttcttt accatttttc aaacttttat gacggatgca       840
     caaaagaatg ttgacctaga agaagtttct gaggatgtaa tacctgaaat aaaaaaacca       900
     gaagatttta atttcggaca atacccacca gattttttcg acttgatagt tattgacgag       960
     tgtcatcgtg gaggtggtaa tgatgaaagt tcttggagag ccataatgga ttatttttcg      1020
     cctgctgtac aattaggttt aactgcaacg ccaaaacgag atgtaaacgg agatacctac      1080
     aattactttg gtgaccctgt ctatacttat aagttaaaag atggtattaa tgatggtttc      1140
     ttaacccctt ttaaggtaaa agaaattcaa accaattatg atgaatacac agtaacagaa      1200
     gatgatacta taattttcgg tgaagcagag gtaggcgata cttttaccta tagggattat      1260
     ggtcgtaaaa ttataattca acaggttgag gaatatagag ttaaaaaatt cttggaaatc      1320
     attaatcaaa accaaaagtc tttggttttc tgtgcaactc aaaagcacgc tgcattaata      1380
     agagatttaa taaatcaaaa tacagatagt aagagtacaa attattgtca tcgtgtaacg      1440
     gcagatgatg gcaaaatggg cgaactgcac ctaagagatt ttcaagacaa tgaaaaaagt      1500
     attcctacta tattaacaac ttcacaaaag ttgagtacgg gtgtagatgc accagaaatt      1560
     agaaacattg ttttacttcg tcctgtagat tccatggtag agtttaagca aatagttggt      1620
     cgtggcacaa ggttatttga tagtaaagat tatttcacct tgttcgattt tgtgaatgct      1680
     cataatcatt ttcaagaccc agaatgggac ggcgaaccta taccgccaga accatcaacg      1740
     ggaggcggaa caccaagagt ttgtaatatt tgcggagaaa caccttgtgt ttgcgaaaga      1800
     ccggagcctg aaccctgtcc tgaatgtgat aatattcctt gtgtttgcga aacaccaccg      1860
     agaagaatga ttaaagttaa actctcggat aacaaagtga gagaaataga ttctatggtc      1920
     aagacttcat tttggagtcc atcaggaaaa ccaatttcct cacaagaatt tattgagcaa      1980
     ttgtttgggg atttaccttc attctttgca agtgaaaatg aattacgaaa aatttggagt      2040
     ttgccaagca cacgcaaaaa attgctaaac gagctaagcg aaaaaggata cacaaactcg      2100
     caattggaag atttgagaaa tttaattcac ggtgaagaaa gtgacctttt tgatgtgtta      2160
     agctacgtag cgtatcacaa agaccttgtt cctcgattag aaagagcagg taaagctaaa      2220
     atccagatga atgactacaa tccaaagcaa caggagtttt tgaactttgt attagagcaa      2280
     tatgtcaaag aaggagttga tgaactggat gacgccaaac ttccaaattt attagaattg      2340
     aagtatcagg ctatcgctga cgccaaaaat gaactaggtg caattaagtc aataagagat      2400
     acctttattg ggtttcagga gttgttgtat cgagataggg caatgtga                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page