(data stored in ACNUC7421 zone)

EMBL: CP002157.PE662

CP002157.PE662       Location/Qualifiers
FT   CDS_pept        complement(718956..719327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02025"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02022"
FT                   /db_xref="GOA:A4AM00"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM00"
FT                   /protein_id="EAR02022.1"
FT                   /translation="MKIFWRVLQILLAVFMIYAGIQHFMKPEFYTPFVPSFLPFEISLI
FT                   YLSGLFEVVFGLLLLIPRYAKLASTGILLLMLVFLPIHIWDVFADTPAIGSHKAALIRL
FT                   PIQFVFIGWAFKVRQFLNK"
     atgaagatat tttggagggt attacaaatt ctattggctg tgtttatgat ttatgctgga        60
     attcagcatt ttatgaagcc cgagttttat acaccatttg ttcctagttt tttgcctttt       120
     gaaataagcc tcatttatct ctctggttta tttgaagttg tttttggttt actgttgctg       180
     attcccagat atgctaaatt ggcgagtact ggaatactat tactcatgtt ggttttttta       240
     ccaatacaca tttgggatgt gtttgcagat acacctgcaa taggtagcca taaagcggca       300
     ttaattcgct tgccaattca gtttgtattt attggctggg catttaaggt taggcagttt       360
     cttaataaat ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page