(data stored in ACNUC7421 zone)

EMBL: CP002157.PE672

CP002157.PE672       Location/Qualifiers
FT   CDS_pept        complement(727537..728745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02075"
FT                   /product="BNR repeat protein putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02075"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02032"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM10"
FT                   /protein_id="EAR02032.1"
FT                   /translation="MRFCLFALAFILFLSCKEEQKREVQLVKFVSSPTGPMSSLPSLSS
FT                   NKDITLISWVEKVNDSLTKLKYARLIGGQWKDPKLITQGEDWFVNWADFPTIAENNGNL
FT                   VSHVLKKSSKKTFSYDVRLNVMGKENSQWAADLQLHSDSTKTEHGFVTTLPYDEAFFIT
FT                   WLDGRNTSGSGHDHHGGAMTIRAAEVSSKGLISNEHVLDERTCDCCQTTAAITANGPVV
FT                   VYRDRSDDEVRDMSIVRLVNGNWTAPKTINNDNWQIKGCPVNGPKADAIDNDLVVAWFT
FT                   EANGEAKVKVTFSSDGGVNFDKPIRIGDTKAMGRVDIALIDAERAIVSWMETINQKALF
FT                   KAVKVNKNGQMGRSIVIDTMAASRKSGFPQMELVQDKIYFAWTDATGDITTVKTANVRL
FT                   DSF"
     atgaggtttt gtttattcgc gcttgctttt attttgtttt tatcatgtaa agaagaacaa        60
     aagagagagg tacaattggt aaagtttgtt tcttcgccga cgggacccat gagttcactg       120
     ccaagtttgt cttctaataa ggatattaca cttatttctt gggttgaaaa agttaatgat       180
     tcattgacga aactgaagta tgcgaggttg ataggtggac aatggaaaga tccgaaatta       240
     ataacgcaag gtgaggattg gtttgtgaat tgggctgatt ttcctaccat agctgagaac       300
     aacggtaatc ttgtttcaca tgttttaaaa aagtcatcaa aaaagacttt ttcgtatgat       360
     gtccgattaa atgtaatggg gaaagagaac tctcaatggg cggcagatct tcaattacac       420
     tcagattcta ccaaaactga acatggtttt gtaacaacat taccatatga tgaggcgttt       480
     tttattactt ggttagatgg tcgtaacacc tcaggttctg gtcatgacca ccatggtgga       540
     gcaatgacca ttagagccgc tgaagtatct tcaaaaggct taataagtaa tgaacatgta       600
     ttggatgaaa gaacctgcga ttgttgccag actactgctg ctataacggc aaatgggcca       660
     gtagttgttt atcgggatag atcggatgat gaggtaagag atatgtctat cgtaaggttg       720
     gtcaatggaa attggacagc tccaaagacc atcaacaatg ataattggca gataaaagga       780
     tgtcctgtaa atggccccaa ggctgatgct attgacaatg atttggttgt agcttggttt       840
     acggaggcga atggtgaagc caaagtaaaa gtcaccttct cctcagatgg tggggttaat       900
     tttgacaaac ctattcgtat aggagatacc aaggctatgg gaagagtgga tattgcactt       960
     attgatgctg aaagggccat agtaagttgg atggaaacaa tcaaccaaaa agcgctcttc      1020
     aaggcagtta aagtaaataa aaatgggcaa atgggaaggt ctatagttat tgatacgatg      1080
     gccgcctcta gaaaatcagg cttccctcaa atggaactgg ttcaagacaa aatatatttt      1140
     gcctggactg atgcaacggg cgatataaca acggttaaaa ctgctaatgt tcgattagat      1200
     agcttttaa                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page