(data stored in ACNUC7421 zone)

EMBL: CP002157.PE678

CP002157.PE678       Location/Qualifiers
FT   CDS_pept        complement(735614..738058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02105"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02038"
FT                   /db_xref="GOA:A4AM16"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM16"
FT                   /protein_id="EAR02038.1"
FT                   /translation="MVISVNVASEIPNYKMSFDFRFLKSLVAPLLFFFFINSIAQSPPD
FT                   TLFFKDRIQLLSSDNIFKTEGYYNWGASIIKDKKGTYHLFYSRWKKDYKFTGWLTHSEI
FT                   AHATSRSPQGPWKFKNTVITGRGKGKWDAITAHNPKIKYFDGKYYLYYISTNLGEKDFT
FT                   EKELIETAHTGYNHANWKILRPNQRTGVAVSNSINGPWTRMGKPLIEPSGPITTLTVNP
FT                   AIDKGKDGRYYLIVKGDKPNEKRFVRNQAIAISKSPLGPFEMQPSPVIDYLDTEDMSMW
FT                   YDAKRDYFYGTFHAHTMIGMISSPDGINWKKATEYALMPKKSLWLGDSEIIPDRMERPF
FT                   IYVEDNQPQVLSMAVKKGDESYTVFVPIKEKEELPVPNKRQLAWQQAEMGAVFHYDLHV
FT                   FDGLKYGQGNNRIDPVKDYQVFNPEKLDTDQWVKAAKDAGFTFAILTATHETGFALFQS
FT                   NVNPYGMKALKFQDGKGDVVRDFVNSCRKYGIKPGIYLGIRWNSFMGVHDFKVNGEGDF
FT                   KVNRQKWYNNMVEKMVKEICTSYGELFEIWFDGGADHPDNGAPDVLPIVQQYQPNCLFY
FT                   HNGQLAEARWGGSESGTVSYPSWATFPYRATGAGESAKENIAKNGFQLLKTGDPNGGYW
FT                   MPAMSDAPLRGYNGRHEWFWEPGDEAHIFPLNNLMEMYYKSVGRNSTLIMGLTPNPDGL
FT                   LPEPDVQRLKEWGDEIRRRFSTPIKSAKGEGAKLVMKLEESRIIDHVIIQEDIKFGERI
FT                   REYKIEGLVNGKWQLLAQGQSVGNKRIEQFDAVKVKRIRLVVTKHTKTPKVKNFSVFFV
FT                   NK"
     atggtcatta gcgttaatgt agcttcagaa atacctaatt acaagatgag ttttgatttt        60
     agatttctta aaagcttagt tgctccactg ttatttttct tttttatcaa ctccattgcc       120
     caatccccac cagacacctt attttttaaa gataggatac aactactttc atcagataat       180
     atttttaaga cagagggtta ttataactgg ggagcctcca ttattaagga caagaaaggc       240
     acctaccatc ttttttactc acgttggaaa aaagactaca agttcactgg ttggttaact       300
     cattcagaaa ttgcccatgc aacatctagg agcccgcaag ggccttggaa atttaaaaac       360
     accgtaatta ccggtagggg aaagggtaag tgggatgcta ttacagccca taatcccaaa       420
     atcaaatatt ttgacggcaa atactactta tactatatat ccaccaactt aggagagaag       480
     gattttactg aaaaagaact tattgagaca gctcacactg gttataacca tgccaattgg       540
     aagattttaa gaccaaatca gcgtactggt gtagcagttt cgaattctat aaatgggcca       600
     tggacacgaa tgggaaaacc attaattgaa ccgtctggcc caattacgac attgacagtg       660
     aatccggcca tagacaaagg aaaagatggc aggtattatt tgatcgtaaa aggagataaa       720
     cccaatgaaa aacgatttgt tagaaaccag gctattgcta tttccaaatc tcctcttggg       780
     ccttttgaaa tgcaaccaag cccagtgatt gattatctcg atactgagga tatgtccatg       840
     tggtatgacg ctaaacgcga ttatttctat ggtacttttc atgcacatac aatgattgga       900
     atgatcagct cgccggatgg tataaattgg aaaaaagcca ccgagtatgc acttatgcca       960
     aaaaaatcgt tatggcttgg agattcagaa attatcccag accgaatgga acggcctttt      1020
     atttatgtag aggacaacca acctcaggta ttgagcatgg ccgtaaagaa gggtgatgag      1080
     tcctatacgg tatttgtgcc tatcaaagaa aaagaagagc ttccagtacc caataaaaga      1140
     caattggcct ggcagcaagc cgaaatgggt gcggtatttc actatgacct ccatgttttt      1200
     gatggtttga aatatgggca gggaaacaac cgtattgacc ctgtaaaaga ctatcaggtt      1260
     tttaatccag aaaaattgga tacagatcaa tgggtaaagg ctgcaaaaga tgctggtttt      1320
     acttttgcca tattaacagc aacccatgaa accggtttcg cgctgttcca atcgaacgta      1380
     aatccttatg gcatgaaggc cttaaaattt caggacggta aaggagatgt ggtacgtgat      1440
     tttgtaaact cgtgccgtaa atatggcata aaacctggta tttatttagg aattcgatgg      1500
     aattcattca tgggagtgca tgattttaaa gtgaacggcg aaggtgattt taaggttaac      1560
     cgccagaaat ggtacaacaa tatggtcgaa aaaatggtca aagaaatctg taccagctat      1620
     ggcgaattgt ttgaaatttg gtttgatgga ggagctgatc atccagataa cggagcgcca      1680
     gatgtgttgc caattgttca gcaatatcaa cctaattgtc tcttttatca caacggtcaa      1740
     cttgcagagg cgcgttgggg cggttcagaa tccgggactg tgtcttatcc gtcatgggct      1800
     acatttccct atagggctac aggagctggc gagagtgcta aggagaatat tgcaaaaaac      1860
     ggatttcagc tattgaaaac tggtgatcca aatggagggt attggatgcc agccatgtca      1920
     gatgctccat tacgtggata taacgggcgt catgaatggt tttgggaacc gggggatgaa      1980
     gcccatattt ttccattgaa taaccttatg gagatgtatt acaaatctgt agggcgtaat      2040
     tctactttga ttatgggcct aacaccaaat cctgatggtt tattgcctga accagatgtt      2100
     caaagattaa aggaatgggg agatgaaata agaagaaggt tctccacgcc gattaaatct      2160
     gcgaagggag aaggtgccaa attggtaatg aaattggaag agtcaagaat aattgaccac      2220
     gtcataatac aagaggatat taaatttggg gaacgaattc gagaatacaa aattgaaggc      2280
     ttggtaaatg ggaaatggca attattggcg caaggacaaa gcgttggaaa taaaaggata      2340
     gaacaatttg atgctgttaa agtaaaacga attcgattgg tggttacaaa acacactaaa      2400
     actcctaagg ttaagaattt tagtgtgttt ttcgtaaata agtaa                      2445
//

If you have problems or comments...

PBIL Back to PBIL home page