(data stored in ACNUC7421 zone)

EMBL: CP002157.PE684

CP002157.PE684       Location/Qualifiers
FT   CDS_pept        complement(746891..749248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02135"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02044"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM22"
FT                   /protein_id="EAR02044.1"
FT                   /translation="MKNLSFILVLFFVTLVGCSPQINDIYIAPSGVNTSQANKNPVFNS
FT                   IKEGIDKVNLLREEGYDDLITLHLLAGDHRLFSPIVISANLGPLKIIGAGSDKTSVKGS
FT                   EKIDIVWEKHDDEIWVANVTKDVGFDQLFVDGKMQILARYPNYSELGGHWQGHAADAIS
FT                   KERVNTWANPKGAIVHAMHRGEWGGFHFEVSGVDEDGGLILKGGHQNNRPSEMHATYRM
FT                   VENVFEELDTAGEWYLDKESSRLYYWPIAGTDLKKAEFEVVRQKHLFEIVGSEENPVEN
FT                   VVIEGIRFEHAQRTVMEKYEPLLRSDWMMYRGAAVFIEGTENVSINDCEFTELGGNAIF
FT                   VSNYNRGTIISNNHIHQIGASAVSFVGSPNAVRSPSFQYGQYVELSEMDTIVGPKTNSY
FT                   PSNSLVDNNLIHRIGRVEKQTAGVQIAMAMKITISNNSIYDVPRAGINIGDGTWGGHII
FT                   DYNDVFNTVLESGDHGAFNSWGRDRFWHPNRNELDKLVIDNPEMPKWDAIHTTIIRNNR
FT                   FRCDHGWDIDLDDGSSNYHIYNNVCLNGGLKFREGFNRIAENNILVNNGFHPHVWFKES
FT                   KDVFMRNIVFTEHKDIRLQGWGKEVDYNFFPDKATLLKTQEKGVDVHSIYGDPLFIDSK
FT                   IGNYSLVNDSPAIEVGFNSFSTDVYGVKNESLKMLAKSPEIPKIFFGVSSDSSAEYKWL
FT                   GSVLKNIETMAERSASGLDNTAGVLILSIEENSTIARSELKVNDVIISSEEDEITTVED
FT                   LMKSFQNNNWKGKLNLQVIRNQKEISVILITK"
     atgaaaaatt tatctttcat tttagtactg tttttcgtta cattggtagg ttgctctcct        60
     caaataaatg atatttatat tgctccatct ggggtcaaca cttcccaagc aaataagaat       120
     ccggttttta attcaattaa agagggaata gacaaagtga acctgttaag agaagaaggt       180
     tatgatgatt tgataacctt gcatttattg gcaggtgatc acaggttgtt ctctccgatt       240
     gtgatatcgg cgaatctggg tccattgaaa attattgggg ctgggagtga caagacaagt       300
     gttaagggtt cagaaaaaat tgatatagta tgggaaaagc atgatgatga gatatgggtt       360
     gcaaatgtga ctaaagatgt aggttttgat caactgtttg tggatggaaa aatgcaaatt       420
     ttggcgagat atccaaatta tagcgagcta ggaggtcatt ggcagggaca tgccgcggac       480
     gcaatttcaa aagaaagggt gaatacatgg gcaaatccta aaggtgcaat tgttcatgct       540
     atgcacagag gagaatgggg tggttttcat tttgaagttt caggtgttga tgaagatggc       600
     ggactgattc tcaaaggagg gcaccaaaat aacagacctt ctgaaatgca tgcaacctat       660
     agaatggtcg aaaacgtatt tgaggaattg gataccgctg gagaatggta tttagataaa       720
     gagtcttcaa gattatatta ctggccgata gctggtaccg atttaaagaa ggcagagttt       780
     gaagtggttc ggcaaaagca tttgttcgaa atagttggtt ctgaagaaaa cccagttgaa       840
     aatgtagtaa ttgaaggtat tcgttttgaa catgcccaaa gaacagtaat ggagaagtat       900
     gaaccgttat tgcgaagtga ttggatgatg tatcgagggg cggcggtatt tatagaaggt       960
     acagaaaatg tttctattaa tgattgtgaa tttacagagt taggcggtaa tgcaattttt      1020
     gtgagcaatt ataatcgagg tacaataatc tcaaacaatc atattcatca aattggagca      1080
     agtgcggtta gttttgttgg tagcccaaat gctgttcggt caccttcttt tcaatacggg      1140
     cagtatgtag aattaagcga gatggataca attgttgggc ctaaaaccaa ttcgtaccct      1200
     agtaattctt tggttgataa taacttgatt catagaattg gacgtgtaga gaagcaaaca      1260
     gcaggggttc agattgcaat ggcaatgaaa atcaccataa gtaataatag tatttatgat      1320
     gtgccaagag caggtattaa tattggtgat ggcacatggg gaggtcatat tattgattat      1380
     aatgatgttt tcaataccgt tttggaatca ggtgatcatg gggctttcaa ttcatggggt      1440
     agagatcgtt tttggcaccc gaataggaac gagttagata aactggttat tgataatcct      1500
     gaaatgccaa aatgggatgc cattcacacc acaataattc gaaataatag gtttcgatgt      1560
     gatcatggtt gggatataga cttggacgat ggttcctcca attatcatat ttataacaat      1620
     gtttgtttga atggaggatt gaaatttaga gaaggattca atcgaatagc tgaaaataat      1680
     attttggtaa acaatggctt tcacccacat gtttggttta aagaaagtaa agatgttttt      1740
     atgagaaata ttgtttttac agaacataaa gatattcgac tacagggatg gggtaaagaa      1800
     gtggattata atttctttcc agacaaggcc acattgctaa aaacacagga gaaaggtgtt      1860
     gacgtccata gtatttatgg agatccttta ttcatcgatt cgaaaattgg caattatagt      1920
     ttagtcaatg attctccagc tattgaagtt gggtttaatt ctttttctac ggatgtctat      1980
     ggcgtaaaaa atgagtcact taaaatgttg gcaaagagcc cggaaattcc aaagatattt      2040
     tttggggtat caagtgatag ctcagcagaa tacaaatggt taggtagtgt tttaaaaaac      2100
     attgagacca tggccgaacg ttcagcttcg gggctggaca atacagctgg agtattaatt      2160
     ttatcaatag aggagaattc tactattgct cgttcagaat taaaggttaa tgatgtcata      2220
     atatcgagcg aagaagatga aataaccaca gttgaagatt taatgaaatc ttttcaaaat      2280
     aataattgga aagggaaatt gaatttgcaa gttattcgta atcaaaaaga aatatccgtt      2340
     atcttgataa caaaatga                                                    2358
//

If you have problems or comments...

PBIL Back to PBIL home page