(data stored in ACNUC7421 zone)

EMBL: CP002157.PE8

CP002157.PE8         Location/Qualifiers
FT   CDS_pept        complement(20590..20901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16171"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00637"
FT                   /db_xref="InterPro:IPR021857"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT67"
FT                   /protein_id="EAR00637.1"
FT                   /translation="MSDKDQKQKQINIELDEKTAEGTYSNLAIINHSVSEFVVDFISMM
FT                   PGAPKAKVKSRIVLTPQHAKKFLKALGDNVSRFEKAHGTIKDYEQPPIPINFGPTGEA"
     atgagcgata aagatcagaa acaaaagcag attaatatag aattggatga aaaaacggct        60
     gagggaacat attccaattt ggccattata aatcattcgg tttctgagtt tgttgttgac       120
     tttatcagta tgatgcccgg agctccaaaa gctaaggtta aaagtagaat tgttcttaca       180
     cctcaacatg ccaagaagtt tttgaaggct ttaggggata atgtgagtag gtttgaaaag       240
     gcccatggca cgattaagga ttatgagcaa cctccgatac caattaattt tggtcctacc       300
     ggagaagctt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page