(data stored in ACNUC7421 zone)

EMBL: CP002157.PE81

CP002157.PE81        Location/Qualifiers
FT   CDS_pept        92403..93182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16536"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00710"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE0"
FT                   /protein_id="EAR00710.1"
FT                   /translation="MAKKGEVTVEEKLRALYDLQLIDSRVDEIRNVRGELPLEVEDLED
FT                   DVLGLKTRLDKLKTDVETVNFEITAKKNLIEESKGLIKKYTEQQKNVRNSREFNSISKE
FT                   LEFQELEIQLAEKNIKEFKAQIEQKKVVISETKEKLSEREAHLKHKKSELNAILAETEK
FT                   EEKALLSKSNEYQEQIEERLVKAYSRIRNNVKNGLAVVPIERGASGGSFFTIPPQVQVE
FT                   IASRKKIITDEHSGRILVDPTLAEEEQLKMEKMFAKL"
     atggcaaaaa aaggtgaagt aaccgtagaa gagaagttaa gagcattata tgacttgcaa        60
     ttaattgatt ctagggttga tgagatacgc aatgttagag gtgaattacc attagaagtt       120
     gaagatttgg aggatgatgt tttaggcctt aaaacaagat tagataagct taaaactgat       180
     gtagagaccg ttaattttga aattactgct aaaaagaatt tgattgaaga atcaaaaggc       240
     ttgattaaaa aatataccga gcagcagaag aatgttcgaa acagtagaga attcaactca       300
     attagtaagg aattggaatt tcaagaactc gaaattcaat tggctgaaaa aaacataaaa       360
     gaattcaaag cccaaataga gcaaaagaaa gtggttatct ctgaaacaaa agagaagtta       420
     agtgaaagag aagcccattt gaagcacaaa aaaagtgaat tgaatgcgat tttggccgaa       480
     actgaaaaag aggaaaaagc tcttttgagc aaatcaaacg aatatcagga acaaattgaa       540
     gaacgattgg ttaaggcata ttctagaatt agaaacaatg taaaaaacgg acttgcagtt       600
     gttcctattg aaagaggtgc ctcaggtggt tcattcttta ctataccacc acaggttcag       660
     gttgagattg cttcgcgcaa aaaaatcatt actgacgagc atagtggtag aatattggtt       720
     gaccctactc ttgcagaaga agagcaacta aaaatggaga aaatgtttgc caagttgtag       780
//

If you have problems or comments...

PBIL Back to PBIL home page