(data stored in ACNUC7421 zone)

EMBL: CP002157.PE82

CP002157.PE82        Location/Qualifiers
FT   CDS_pept        complement(93252..94595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16541"
FT                   /product="monooxygenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16541"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00711"
FT                   /db_xref="GOA:A4ATE1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR027545"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE1"
FT                   /protein_id="EAR00711.1"
FT                   /translation="MSQTSKNIAIVGSGLVGSLLAIYLRKLGHAITVFDRRPDIRTIEF
FT                   SGRSINLAMSNRGWRALDEIGIEEEIKKIAIPLDKRAMHVVGKPMYFQHYGEEGEAIWS
FT                   ISRGVLNRKMIDLAEEAGVKFKFEEKVWDVDLPAAKLQTGETEKGEWKEYAYDLIFGCD
FT                   GAFSRIRHKMQRRSRFDYSQDFIDVGYKELTIPANSDGSHKLDANSFHIWPRGRFMFIA
FT                   MPNIDGSFTCTLFMPFEGDISFESIRTHEEARTFFRTHFPSVDQEIENLAHDFFKNPTS
FT                   AMVTMKCYPWTYWDKVALVGDSAHAIVPFYGQGMNAGFEDIFVLNKIIKEEGDNWEAIF
FT                   QQYQKKRKPNADAIAELSYRNFMEMSSKTADPKFLMQKKIEKRFAQKYPDKWVPLYSRV
FT                   TFSHRPYSEALAIGNAQEKIMSQIMDFPDIEKKWDSDEIEQEILNMLP"
     atgagtcaaa catcaaaaaa cattgctata gtggggtccg gtttagtggg ctcactttta        60
     gctatctact tgagaaaatt aggacacgcc attacagttt ttgacagaag acctgatatt       120
     agaacaatag aattttcggg acgttcaatt aacctcgcca tgagtaatag ggggtggagg       180
     gcactggatg aaattggaat agaggaggag ataaaaaaaa tagcgatacc tcttgataaa       240
     cgagcaatgc acgtagttgg taaacccatg tattttcagc attatggcga agaaggggag       300
     gcgatatggt ctatatcaag aggggtgtta aatcggaaga tgattgattt ggctgaagaa       360
     gccggtgtta aattcaaatt tgaagaaaaa gtatgggatg ttgatctccc agcagccaaa       420
     ttgcaaacag gagaaaccga aaaaggggaa tggaaggagt acgcttacga tttgattttt       480
     ggttgtgatg gagctttttc aagaattcgt cataaaatgc aacgtcggag caggtttgat       540
     tattcacagg attttattga tgttggatac aaagaattga ccattcctgc taattcagat       600
     ggcagccata agttagatgc caattcattt catatatggc cacgcggtcg atttatgttc       660
     atagcgatgc caaatatcga tggtagtttt acctgtactc tgttcatgcc ctttgaaggg       720
     gatatttctt ttgaaagtat tagaacccat gaggaagcca ggactttttt tagaacccat       780
     ttcccaagtg tagaccagga aatagagaat ctagcacatg attttttcaa gaaccccacc       840
     agtgcaatgg taacaatgaa atgctaccct tggacctatt gggacaaagt agctctagtg       900
     ggtgattcag cgcatgcaat tgtacccttt tacggacaag gaatgaatgc cggttttgag       960
     gacatttttg tgttgaataa aattattaaa gaagaaggcg ataattggga ggcgattttt      1020
     cagcaatacc agaaaaaacg aaaaccaaat gcagatgcca ttgcagagct gagttatcgt      1080
     aattttatgg agatgagtag taaaacagcc gacccaaagt tcttaatgca aaaaaagata      1140
     gaaaaaaggt ttgcacaaaa gtatcctgat aagtgggtgc cattatactc aagagttacc      1200
     ttttcacata ggccttattc tgaagctttg gccataggca acgcacagga aaagataatg      1260
     tcacaaatta tggatttccc agatattgaa aaaaaatggg acagcgatga aattgagcag      1320
     gaaattttga atatgttacc ttaa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page