(data stored in ACNUC7421 zone)

EMBL: CP002157.PE83

CP002157.PE83        Location/Qualifiers
FT   CDS_pept        complement(94851..95399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16546"
FT                   /product="Protease subunit of ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16546"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00712"
FT                   /db_xref="GOA:A4ATE2"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE2"
FT                   /protein_id="EAR00712.1"
FT                   /translation="MSSKKGKVQEAIDEKLLEERKVFLWGMVDDDSAKHVIDRLLYLDM
FT                   QNNKEIQLFINSPGGYVTSGFAMYDTIKSLKSPVSTICTGLAASMGSILLSVGKKGRRF
FT                   IQPHAQVMIHQPSGGARGQASNIEIQAKEIIKTKELSAQILADNCGQDFDTVMRDFDRD
FT                   YWMNAEESIEYGIVDGVLE"
     atgagttcta aaaaaggaaa agtacaggaa gcaatagatg agaaattatt agaagaaaga        60
     aaagtgtttc tatggggaat ggtagatgat gattctgcaa aacatgttat tgatcgcttg       120
     ctgtatttag atatgcagaa taataaagaa attcagcttt ttattaatag tcctggaggg       180
     tatgtaacct ctggatttgc aatgtacgat acgataaaat cattaaagag tcctgtatca       240
     acgatttgta ccggtttggc ggcctcaatg ggttcaatac tgctttctgt ggggaaaaaa       300
     ggaagacgtt ttattcaacc acatgcgcaa gttatgattc accaaccaag tggtggagca       360
     agagggcaag catctaatat cgaaattcag gccaaagaaa tcatcaaaac caaagaattg       420
     agtgctcaaa ttttagcaga taattgcgga caggattttg atacggtcat gcgagatttt       480
     gatagggatt actggatgaa tgcagaagaa tcgatagaat acggtatcgt tgacggagtt       540
     ttagaatag                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page