(data stored in ACNUC7421 zone)

EMBL: CP002157.PE84

CP002157.PE84        Location/Qualifiers
FT   CDS_pept        95399..96187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16551"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00713"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE3"
FT                   /protein_id="EAR00713.1"
FT                   /translation="MHFYLIIKTKHFIKYSWNDKKLISIEITWIHLSLKKMYKMRYVII
FT                   LLLLSIISGCKTDKKKEALVIEKEYTLSEKIANANGFQNWKEVTQLKFTFNVDRDTSHF
FT                   ERTWIWDIKENQVTSISNNETIIYNRAKLDSTSHQINGGFVNDKYWLLAPFNLIWDKDN
FT                   YTHNLKEDVVAPISKKAMQKLTITYSSDGGYTPGDAYDFYFEDDFQIKEWVFRKANQPE
FT                   PSLITTWEDYVEKGGLKIAQTHKNDEGFKLYFTEIEVNTK"
     ttgcattttt atttaattat caaaactaag cattttatta aatatagttg gaatgacaag        60
     aaactgattt ctattgaaat aacatggatt catctatctt tgaaaaaaat gtacaaaatg       120
     agatatgtca tcatactttt acttttgagt ataatttcgg gctgtaaaac tgataaaaag       180
     aaggaagccc tggttattga gaaagaatat accctttcag aaaaaatagc taatgctaat       240
     gggtttcaaa actggaaaga agttactcaa ctaaaattta cctttaatgt tgacagggac       300
     acttcacact tcgaaagaac gtggatttgg gatataaaag aaaaccaagt tacgtctatc       360
     tctaataacg aaacaataat atacaataga gcaaaattag atagcaccag ccatcaaata       420
     aacggtggat tcgtgaatga taaatattgg ttgttggcac ctttcaatct aatttgggac       480
     aaagacaatt acactcacaa cctaaaagag gatgtagttg ctccgattag taagaaagcc       540
     atgcaaaaac tcactataac ttatagttca gatggaggtt acacccccgg agatgcctat       600
     gatttttatt ttgaagacga ctttcaaatc aaagaatggg tttttagaaa agccaatcaa       660
     cctgaacctt cattaattac cacttgggaa gattatgttg aaaaaggtgg gttgaaaatt       720
     gcccaaacgc acaaaaatga tgaaggtttt aaactatatt tcaccgaaat cgaagtgaat       780
     acaaaataa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page