(data stored in ACNUC7421 zone)

EMBL: CP002157.PE89

CP002157.PE89        Location/Qualifiers
FT   CDS_pept        100232..100873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16576"
FT                   /product="O-methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16576"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00718"
FT                   /db_xref="GOA:A4ATE8"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE8"
FT                   /protein_id="EAR00718.1"
FT                   /translation="MHFLSQVLENYIENSSENEPELLKKLSRETHLKVIQPRMITGHFQ
FT                   GRVLSLLSKIINPTNILEIGTYTGYSALCLAEGLKKNGTLHTIDINEELADIQRKYFEE
FT                   SGFGHQIIQHAGDALKIIPEMNETFNLVFIDAEKREYPEYFEAVMEKTSSGSIILSDNV
FT                   LWSGKVVEPLNEKDIATKTLLGYNKKLKEDSRVETVLLPIRDGLTLSRVL"
     atgcactttt tatcccaagt tttagaaaat tatattgaaa atagttcgga aaacgagcct        60
     gaattattaa aaaagctttc aagggaaaca catttaaagg taattcaacc cagaatgata       120
     accgggcatt ttcaaggaag ggtcttgagt ctactatcaa aaatcatcaa ccccacgaac       180
     atattagaaa taggaaccta cacgggttat tcagctttgt gtttggccga aggattgaaa       240
     aaaaatggca cacttcatac aattgacatt aatgaggaac ttgccgatat tcagcgaaaa       300
     tattttgaag agagtggatt tggccatcaa ataatacaac atgctggcga tgccttgaaa       360
     attattccag aaatgaacga gacttttaat ttagtattta ttgatgctga aaaaagggaa       420
     tatccagaat attttgaagc agtaatggaa aaaacctctt ctgggagcat aatcttatcg       480
     gacaatgtgc tttggtctgg aaaagttgta gagcctctaa acgaaaaaga catagcaaca       540
     aaaacacttt tgggttataa taaaaagctc aaggaagatt caagagtaga aactgtgctt       600
     ttaccgatca gggatgggtt aaccttaagt agggtactat aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page