(data stored in ACNUC7421 zone)

EMBL: CP002157.PE90

CP002157.PE90        Location/Qualifiers
FT   CDS_pept        complement(100839..101411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16581"
FT                   /product="PAP2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16581"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00719"
FT                   /db_xref="GOA:A4ATE9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE9"
FT                   /protein_id="EAR00719.1"
FT                   /translation="MLDRILQWDRETFIYLNSLGIEKYDTFWSTVTNIYTWIPLFLFFF
FT                   LLIFWKDPKKEAIYKTLTVILLICFILVATDLTKEFFERLRPNNNSEINSIIRVLKNPS
FT                   SFSFFSGHAASSFSITTLIVLFLRKKVKWCWVFYTWPLLFALSRIYLGVHYPVDIIVGA
FT                   IVGLLSAFGFYNIYKRIIVPYLRLTHP"
     atgctcgata gaattcttca atgggatagg gaaaccttta tttatttaaa tagtttggga        60
     atagaaaagt atgatacttt ttggtcaacc gtgaccaata tctatacttg gattcccctg       120
     tttttgtttt tcttccttct tattttttgg aaagacccta aaaaagaggc aatctataag       180
     accttgacgg taatcttatt gatttgcttt attcttgtgg ccacagattt gaccaaagag       240
     ttttttgaac ggttaaggcc aaacaacaat tctgagatca actcgattat tcgtgtactt       300
     aaaaatccat caagttttag tttcttctca gggcatgctg ccagctcatt ttcaattaca       360
     actttgattg ttttgttctt aagaaaaaaa gtaaaatggt gttgggtgtt ttacacatgg       420
     ccgcttctat ttgccttaag cagaatctat ttaggtgtac attacccagt agatattatt       480
     gttggtgcta tagtgggctt actgtctgca tttggtttct acaacattta taaaaggatt       540
     atagtaccct acttaaggtt aacccatccc tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page