(data stored in ACNUC7421 zone)

EMBL: CP002157.PE93

CP002157.PE93        Location/Qualifiers
FT   CDS_pept        complement(104214..104729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16596"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00722"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF2"
FT                   /protein_id="EAR00722.1"
FT                   /translation="MMKMKFIKKSLLLLLLPLFAFTTAHKFYVSVTNISYSEKDKAIQI
FT                   TSRLFIDDIEKVLEERYGFKTQLATEAESKMTDSYIEKYLKTKFLVYANDNQMQYNFIG
FT                   KKYDNDVMICYLEIPEVDIEKIKSIKVQNELLTDLFDDQQNVVHFKIKGKKKSFVLIKE
FT                   NNKGMLKL"
     atgatgaaga tgaaatttat aaaaaagagt ttacttcttt tacttttacc cttgtttgcc        60
     tttaccacgg cacataagtt ttatgtaagt gtcactaata tttcttattc cgagaaggat       120
     aaggccatac agattacttc ccgactattt atagatgata ttgaaaaggt tttggaggaa       180
     cgctatggct ttaaaaccca actcgccacc gaagctgagt ctaaaatgac tgatagctat       240
     attgagaaat accttaaaac aaagttcctt gtttatgcca acgataatca aatgcagtac       300
     aattttatag gcaaaaagta tgataatgat gtaatgatct gctatctgga gattcctgaa       360
     gttgatattg aaaaaataaa atcaataaaa gttcaaaatg aactacttac cgaccttttt       420
     gacgaccagc agaatgttgt acattttaaa ataaagggca agaaaaaaag ctttgtactc       480
     atcaaagaga ataataaagg aatgttaaaa ttataa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page