(data stored in ACNUC7421 zone)

EMBL: CP002157.PE95

CP002157.PE95        Location/Qualifiers
FT   CDS_pept        complement(105600..106343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16606"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00724"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF4"
FT                   /protein_id="EAR00724.1"
FT                   /translation="MGTTLGAQSLFVKQIEGRVYSKNEDVAATHVLNITADKASITDLN
FT                   GFFSITAKLNDTLVFSAIQFKRKIVVISNEVLKSKLLYVPLEDAVNELDEVIVMPYNLT
FT                   GDMSTDLSRAEIEPVVTASTLGLPNAYVVPPTQAERKLYEATTGGGILPLNPILNGISG
FT                   RTKMLKERVARNEKYERTQRVRAFYPDSLYRIEFKIPEVNIDDFMYFCEVDTAFQVVVD
FT                   SHDRFKIWEFMRKKSVVYRKNNELD"
     atgggcacca ccttgggcgc acaatcttta tttgtaaagc aaatagaagg tcgtgtttat        60
     agtaaaaatg aagatgttgc ggctacccat gtactaaata taaccgccga taaagcttca       120
     attacagatt taaacggctt tttctcaatt accgccaagc ttaacgatac gttggtgttt       180
     tccgctattc agttcaaaag aaagattgtt gtcatttcca atgaagtact aaaaagcaag       240
     ttgctttatg tgcctttaga ggatgccgta aacgagcttg atgaagtaat tgttatgcct       300
     tataacctca ctggggatat gtcaactgat ttatcgcgtg cagaaattga acccgtggtt       360
     actgcttcaa ccttgggatt gccaaatgct tatgtagtac ccccgaccca agctgagcgt       420
     aagttgtatg aagccactac tggcggcgga attttaccgc tgaaccctat cttaaacggc       480
     atttctggcc gtacaaaaat gcttaaagag cgggttgccc gcaatgaaaa gtatgaacgt       540
     acccaaaggg taagggcatt ttatccggac tctttatatc gcattgagtt taaaatacca       600
     gaggtaaaca tagacgattt catgtacttc tgtgaggtgg ataccgcttt tcaagttgta       660
     gttgactctc atgacagatt taagatttgg gagttcatgc gtaaaaaaag tgttgtttat       720
     agaaaaaaca atgaacttga ttaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page