(data stored in ACNUC7421 zone)

EMBL: CP002157.PE99

CP002157.PE99        Location/Qualifiers
FT   CDS_pept        112006..116301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16626"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00728"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF8"
FT                   /protein_id="EAR00728.1"
FT                   /translation="MTAQVKIGENPNNIDAASIIELESTTKALVLTRVSTTQMQSISPL
FT                   RGALVYNIDVQCVYYFDGNNWINLCDNNSNKTGTAIISTIDNNNGTFTFNYSDGTNFTT
FT                   SNLIGPTGAKGDKGDKGDTGAAGADGINGTNGTDGAKGDKGDKGDTGAAGADGLNGTNG
FT                   TDGAKGDKGDKGDTGAAGAAGIDGTNGIDGTNGTDGAKGDKGDTGAAGADGINGTNGTD
FT                   GAKGDKGDKGDTGAAGVDGIDGTNGTDGAKGDKGDKGDTGTAGADGINGTNGIDGAKGD
FT                   KGDKGDTGAAGTDGTNGTNGIDGAKGDKGDKGDTGAAGADGINGTNGTDGAKGDTGDTG
FT                   AAGADGINGTNGIDGTNGIDGAKGDKGDKGDTGAAGADGINGTNGIDGTDGAKGDKGDK
FT                   GDKGDTGAAGAAGTDGTNGTNGIDGAKGDKGDKGDTGAAGAAGINGTNGTDGAKGDTGD
FT                   TGAAGADGINGTNGIDGTNGIDGAKGDKGDKGDTGAAGADGINGTNGIDGTDGAKGDKG
FT                   DKGDTGAAGADGINGTNGIDGAKGDKGDKGDTGDTGAAGADGINGTNGTDGAKGDKGDK
FT                   GDTGAAGADGLNGTNGIDGAKGDKGDKGDTGAAGADGINGTNGTDGAKGDTGDTGDTGA
FT                   AGADGINGTNGIDGTNGIDGTNGIDGAKGDKGDTGAAGADGTNGTNGIDGTKGDKGDKG
FT                   DTGAAGANGINGTNGIDGAKGDKGDKGDTGASGADGINGTNGTDGAKGDKGDTGAAGAD
FT                   GINGTNGTDGAKGDKGDKGDKGDTGTAGADGINGTNGTDGAKGDTGDTGAAGADGINGT
FT                   NGIDGTNGIDGAKGDKGDKGDTGAAGADGINGTNGIDGTDGAKGDKGDKGDTGAAGADG
FT                   INGTNGIDGAKGDTGDTGAAGADGINGTNGIDGTNGIDGAKGDKGDKGDTGAAGADGIN
FT                   GTNGIDGTDGAKGDKGDKGDTGAAGADGINGTNGIDGAKGDKGDKGDKGDTGTAGIDGI
FT                   NGLDGTNGIDGTDGAKGDKGDKGVTGAAGADGINGTNGIDGAKGDKGDKGDTGAAGADG
FT                   INGTNGIDGAKGDKGDKGDTGAAGTDGINGTNGLDGTNGIDGDKGDKGDKGDTGTAGID
FT                   GINGLDGTNGIDGTDGAKGDKGDKGVTGAAGADGINGTNGIDGAKGDKGDKGDTGAAGA
FT                   DGINGTNGIDGAKGDKGDKGDTGAAGTDGINGTNGLDGTNGIDGAKGDKGDKGDTGAAG
FT                   AAGIDGTNGIDGTNGTDGAKGDKGDKGDKGDTGAAGAAGIDGTNGIDGTNGTDGAKGDK
FT                   GDKGDKGDKGDKGDKGDKGDTGAAGADGINGTDGAKGDKGDKGDDGDSFIKAFGKVNSN
FT                   GSALRIQNATVQRLSTGRYRVTLSSSRSTANYIVQLTVEESYSRRDNIDIHITSQTSSS
FT                   FEVVISEGDNGGTANTVRDRKWHFTVMDY"
     atgactgctc aggtcaaaat tggagaaaat ccgaataaca tagatgcagc ttccattatt        60
     gaattggaga gcacgactaa ggccttggtt cttacccgag tctctacaac gcaaatgcaa       120
     agcatttcac cacttagagg tgctttggtc tataatatcg atgtacaatg tgtttactat       180
     ttcgatggaa acaattggat aaacctatgc gataataatt ccaataaaac tggaacagcc       240
     attatatcta caatcgacaa taacaacgga acatttactt tcaattattc cgatggtaca       300
     aatttcacaa cttcaaacct tattggacct accggggcaa aaggagataa aggagacaaa       360
     ggtgataccg gagctgctgg tgcagatggt atcaacggaa ccaacggaac tgatggtgct       420
     aagggtgaca aaggagataa aggtgatacc ggagctgctg gtgcagatgg tctcaatgga       480
     accaacggaa cagatggcgc taaaggggat aaaggtgaca agggcgatac cggagctgct       540
     ggtgcagctg gtattgacgg aaccaacgga atagatggaa ccaacggaac tgatggtgct       600
     aaaggtgata aaggtgatac cggggctgct ggtgcagatg gtatcaatgg aaccaacgga       660
     actgatggtg ctaagggtga caaaggagat aaaggtgata ccggagccgc tggtgtagat       720
     ggtattgacg gaaccaacgg aacagatggt gctaaaggtg acaaaggtga caaaggtgat       780
     accggaacag ctggtgcaga tggtattaat ggaaccaacg gaatagatgg cgctaaaggt       840
     gacaaaggtg acaagggtga taccggtgca gctggtactg atggaaccaa tggaaccaac       900
     ggaatagacg gtgctaaagg tgataaaggt gacaagggtg ataccggagc tgccggtgca       960
     gatggtatta atggaaccaa cggaacagat ggcgctaaag gagatactgg agatactgga      1020
     gctgccggtg cagatggaat caacggaacc aacggaatag acggaaccaa cggaatagat      1080
     ggtgctaaag gtgacaaagg tgacaagggt gataccggag cagctggtgc agatggtatc      1140
     aacggaacca atggaataga cggaacagat ggcgctaaag gtgacaaggg tgacaagggt      1200
     gacaagggcg ataccggagc tgctggtgca gctggtactg atggaaccaa tggaaccaac      1260
     ggaatagacg gtgctaaagg tgataaaggt gacaagggtg ataccggagc tgccggtgca      1320
     gctggtatta atggaaccaa cggaacagat ggcgctaaag gagatactgg agatactgga      1380
     gctgccggtg cagatggaat caacggaacc aacggaatag acggaaccaa cggaatagat      1440
     ggtgctaaag gtgacaaagg tgacaagggt gataccggag cagctggtgc agatggtatc      1500
     aacggaacca atggaataga cggaacagat ggcgctaaag gtgacaaggg tgacaagggc      1560
     gataccggag ctgctggtgc agatggtatc aatggaacta acggaataga cggtgctaaa      1620
     ggtgataaag gtgacaaggg tgataccggt gataccggag ccgctggtgc agatggtata      1680
     aacggaacca acggaactga tggtgctaag ggtgacaaag gagataaagg tgataccgga      1740
     gctgctggtg cagatggtct caatggaacc aacggaatag acggtgctaa aggtgataaa      1800
     ggtgacaagg gtgataccgg agctgccggt gcagatggta ttaatggaac caacggaaca      1860
     gatggcgcta aaggagatac tggagatact ggagatactg gagctgccgg tgcagatgga      1920
     atcaacggaa ccaacggaat agacggaacc aacggaatag acggaaccaa cggaatagat      1980
     ggtgctaaag gcgacaaagg tgataccgga gctgctggtg cagatggaac caatggaacg      2040
     aacggaatag atggtactaa aggtgacaaa ggagataaag gtgataccgg agccgctggt      2100
     gcaaatggta tcaatggaac caacggaata gacggcgcta aaggtgataa aggcgacaaa      2160
     ggtgataccg gagcttccgg tgcagatggt attaatggaa ccaacggaac tgatggtgct      2220
     aaaggtgata aaggtgatac cggggctgct ggtgcagatg gtatcaatgg aaccaacgga      2280
     actgatggtg ctaaaggaga taaaggtgac aaaggtgaca aaggtgatac cggaacagct      2340
     ggtgcagatg gtattaatgg aaccaacgga acagatggcg ctaaaggaga tactggagat      2400
     actggagctg ccggtgcaga tggaatcaac ggaaccaacg gaatagacgg aaccaacgga      2460
     atagatggtg ctaaaggtga caaaggtgac aagggtgata ccggagcagc tggtgcagat      2520
     ggtatcaacg gaaccaatgg aatagacgga acagatggcg ctaaaggtga caagggtgac      2580
     aagggcgata ccggagctgc tggtgcagat ggtatcaatg gaaccaacgg aatagatggc      2640
     gctaaaggag atactggaga tactggagct gccggtgcag atggaatcaa cggaaccaac      2700
     ggaatagacg gaaccaacgg aatagatggt gctaaaggtg acaaaggtga caagggtgat      2760
     accggagcag ctggtgcaga tggtatcaac ggaaccaatg gaatagacgg aacagatggc      2820
     gctaaaggtg acaagggtga caagggcgat accggagctg ctggtgcaga tggtatcaat      2880
     ggaaccaacg gaatagacgg tgctaaaggt gataaaggtg acaaaggaga caagggtgac      2940
     accggtaccg ctggtattga tggaatcaat ggattagatg gaaccaacgg aatagacgga      3000
     acagatggcg ctaaaggtga taaaggtgac aagggggtta ccggagccgc tggtgcagat      3060
     ggtatcaatg gaaccaacgg aatagatggt gctaaaggtg acaagggtga caaaggagat      3120
     accggagctg ctggtgcaga tggtattaat ggaaccaacg gaatagacgg cgccaaagga      3180
     gataaaggtg acaagggcga taccggagcc gctggtacag atggtatcaa tggaaccaac      3240
     ggattggatg gaaccaacgg aatagatggt gataaaggtg acaaaggaga caagggtgac      3300
     accggtaccg ctggtattga tggaatcaat ggattagatg gaaccaacgg aatagacgga      3360
     acagatggcg ctaaaggtga taaaggtgac aagggggtta ccggagccgc tggtgcagat      3420
     ggtatcaatg gaaccaacgg aatagatggt gctaaaggtg acaagggtga caaaggagat      3480
     accggagctg ctggtgcaga tggtattaat ggaaccaacg gaatagacgg cgccaaagga      3540
     gataaaggtg acaagggcga taccggagcc gctggtacag atggtatcaa tggaaccaac      3600
     ggattggatg gaaccaacgg aatagatggt gctaaaggtg acaaaggaga caaaggtgat      3660
     accggagctg ctggtgcagc tggtattgac ggaaccaacg gaatagacgg aaccaacgga      3720
     actgatggcg ctaaaggaga taaaggcgac aaaggagaca agggtgatac cggagctgct      3780
     ggtgcagctg gtattgacgg aaccaacgga atagacggaa ccaacggaac tgatggcgct      3840
     aaaggagata aaggtgacaa aggtgataaa ggtgataaag gtgacaaagg tgacaagggt      3900
     gacaagggcg ataccggagc tgctggtgca gatggtatca acggaactga tggcgccaaa      3960
     ggagataaag gtgacaaggg tgatgacgga gattccttta taaaggcatt tggcaaagtt      4020
     aattccaatg gatcggcatt acgtattcaa aatgcgacgg ttcaaaggtt atccacagga      4080
     agatataggg tcactctaag ttcatcaaga tccacagcaa actatattgt tcaattaaca      4140
     gttgaagaat cttattccag aagggacaat atcgatattc atattacatc ccaaacttct      4200
     tcaagctttg aagtagtcat ttcagaagga gacaatggag gtacggctaa tacagtaaga      4260
     gatagaaagt ggcactttac cgtaatggat tattaa                                4296
//

If you have problems or comments...

PBIL Back to PBIL home page